KEGG   Bdellovibrio exovorus: A11Q_1670Help
Entry
A11Q_1670         CDS       T02492                                 

Definition
(GenBank) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bex  Bdellovibrio exovorus
Pathway
bex00860  Porphyrin and chlorophyll metabolism
bex01100  Metabolic pathways
bex01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A11Q_1670
Enzymes [BR:bex01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     A11Q_1670
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     A11Q_1670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_3 FAD_binding_2 Pyr_redox Thi4 NAD_binding_9 Pyr_redox_2 DUF4264 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AGH95886
UniProt: M4VCX0
Position
complement(1691506..1692759)
Genome map
AA seq 417 aa AA seqDB search
MSETKAPPSVAIIGSGFSGMTLAWALSKQGISCEIFESSSRSGGLIFTDRKEAILAESAA
NALLSNQHVETLFQDLGLKPLVAGFRSNKRWIFRNKPQRLPLTLLEIVQSASRLLKAKLT
NKLHPFADETVADWGIRCFGHSFTQNLLTPALQGIYGVGAAHLSADLVIGGVLKPQIKIP
KGQLRGSISSENGLYTVIESLEKYLKLQRVVFHYQQQVEISDLQKKFAAVVVATSYLNSS
QLLKSVAPQLSESLAQVPAVGLDVVVMGFKKEKPLQGFGCLFPREQGFNSLGVLFNTDIF
AGRGSLQSESWIVPHQASPALTEDELVQHVLSDRKQMLQYHDEPEFKKVTRWPKALPLYG
FELKKVLNSDLLKNRMRVSEAKSPVYLTGNYLGAIGLGKILGRNLKLADVIREEIAE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaacaaaagcgcccccatcagttgctattatcggttctggtttttctggaatg
actttagcgtgggcgctctcgaagcaagggatttcttgcgagattttcgagtcctcttca
cgcagtgggggcttgatttttaccgatcgaaaagaggccattttggcagagagtgctgcg
aatgctcttttgtcaaaccagcatgtggaaaccctgtttcaagatttaggtttaaaacct
cttgtggctgggttccgttcaaataagcgctggattttccgtaacaaaccacaacgattg
ccgctaacacttttagaaatagtccaaagtgctagtcgtctattaaaagctaagttgacc
aataagcttcatccatttgctgatgaaactgtggctgattgggggatacgctgttttggt
catagttttacccagaaccttttaactcctgctttgcaaggtatttacggagtgggagct
gcgcacttatccgctgatttagttattggtggagttttaaaaccacaaattaaaattcct
aaaggccaattgcgcggcagtatttcttccgagaatggtctttatacagtaatcgagtct
ttagaaaaatatttgaaattgcagagagtagtttttcactatcagcagcaggttgaaatt
tcagatttacagaagaagtttgcagcggtagtggtggcgacgtcgtatctaaattcgtca
cagctcttaaagtcagtagcaccacagttgtcagagtctttagcgcaagttccagcggtg
ggtttagatgtcgtggtgatgggctttaaaaaagaaaaacccctacagggttttggctgt
ctttttcctcgagagcaggggtttaattccctcggggtattatttaacacagatattttt
gcggggcggggttctttacaaagtgaaagctggattgtgcctcatcaggcatcgccagca
ctgaccgaggatgaattagttcagcatgttctttcagatcgtaagcaaatgcttcaatac
cacgatgaacctgaatttaaaaaggtaacacgatggccgaaggctttaccactgtatggg
tttgagctgaagaaggtgctaaatagtgatcttttaaaaaaccgtatgcgtgtatcagag
gcgaagtctccggtttatcttactggaaattatttaggggctattggcttaggaaaaatt
ttaggtcgtaatctaaaattagctgatgtgattcgggaagagattgcagaatga

DBGET integrated database retrieval system