KEGG   Bdellovibrio exovorus: A11Q_2159Help
Entry
A11Q_2159         CDS       T02492                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bex  Bdellovibrio exovorus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bex00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    A11Q_2159
Enzymes [BR:bex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     A11Q_2159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2198753..2199343)
Genome map
AA seq 196 aa AA seqDB search
MSGWIEVVAGSMYSGKTEELIRRVRRAQYAKLKVQVFKPIIDQRYHQTNVTSHNQNQVEA
TPLANIHDVWDHLADDTKVVAFDEGQFFTMELVPVCRDLAARGVRVIISGLDMDWKGQPF
EPIPTLMAIAEDVTKHRAICTKCGELATYTQKIGGSADSQIEVGSQQFYEARCRLHFRPV
VEALDESSRAEMTLTI
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgagcggttggatcgaagttgtagcgggttctatgtacagtggaaaaacagaagagctg
atcagacgtgtgcgtcgcgctcaatacgctaaattaaaagtacaagtttttaaacctatt
atcgatcagcgctatcaccaaacgaatgtgacatctcataatcaaaaccaagtggaagcc
actcctttggcgaatatccatgatgtttgggatcatttggcagatgacacgaaagttgtc
gcttttgacgaaggacaattcttcacaatggagcttgtacctgtttgccgtgacttagcg
gcgcgtggagtgcgtgtgatcatctcgggattggatatggactggaaaggtcaacccttt
gagcccattccaacattgatggcgattgcagaagatgtgacaaaacatcgtgcgatttgc
actaagtgtggtgagctagccacctacacacaaaaaattggtggttctgcagactcacaa
attgaagtgggatcacaacagttctatgaagcccgttgccgtcttcacttcagacctgtg
gtcgaagcgttagatgagtcatctcgcgctgaaatgactttgactatctaa

DBGET integrated database retrieval system