KEGG   Bdellovibrio exovorus: A11Q_2159Help
Entry
A11Q_2159         CDS       T02492                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bex  Bdellovibrio exovorus
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bex00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2198753..2199343)
Genome map
AA seq 196 aa AA seqDB search
MSGWIEVVAGSMYSGKTEELIRRVRRAQYAKLKVQVFKPIIDQRYHQTNVTSHNQNQVEA
TPLANIHDVWDHLADDTKVVAFDEGQFFTMELVPVCRDLAARGVRVIISGLDMDWKGQPF
EPIPTLMAIAEDVTKHRAICTKCGELATYTQKIGGSADSQIEVGSQQFYEARCRLHFRPV
VEALDESSRAEMTLTI
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgagcggttggatcgaagttgtagcgggttctatgtacagtggaaaaacagaagagctg
atcagacgtgtgcgtcgcgctcaatacgctaaattaaaagtacaagtttttaaacctatt
atcgatcagcgctatcaccaaacgaatgtgacatctcataatcaaaaccaagtggaagcc
actcctttggcgaatatccatgatgtttgggatcatttggcagatgacacgaaagttgtc
gcttttgacgaaggacaattcttcacaatggagcttgtacctgtttgccgtgacttagcg
gcgcgtggagtgcgtgtgatcatctcgggattggatatggactggaaaggtcaacccttt
gagcccattccaacattgatggcgattgcagaagatgtgacaaaacatcgtgcgatttgc
actaagtgtggtgagctagccacctacacacaaaaaattggtggttctgcagactcacaa
attgaagtgggatcacaacagttctatgaagcccgttgccgtcttcacttcagacctgtg
gtcgaagcgttagatgagtcatctcgcgctgaaatgactttgactatctaa

DBGET integrated database retrieval system