KEGG   Bdellovibrio exovorus: A11Q_2171Help
Entry
A11Q_2171         CDS       T02492                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bex  Bdellovibrio exovorus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bex00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A11Q_2171
  Amino acid metabolism
   00330 Arginine and proline metabolism
    A11Q_2171
Enzymes [BR:bex01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     A11Q_2171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2211483..2212415)
Genome map
AA seq 310 aa AA seqDB search
MLDHRFSYIEAPVYQGQKNFGTALGPAFLRQSLLDQGFQFNTYSVQVSQSQKHMPFSIYE
ELSWLTERELRRANPIFIAGGDHSLSIGSVQGLLRAEPDLKVIWVDAHGDVNTRASSMTG
SYHGMPLAYLLGAENADHLPWFTERLKPQNLIYFGVRDLDQAEQEYLDQQGITYYTAEQI
HKTPETIIQKVSCAVKGAKVHFSVDCDGFDPMIAPSTGVPVAQGLQYQVVRDLICQVQSQ
SQIVSYEYVELNPQIFQQAHDVMATAQIGIELFKEILNGYKTQGAIHGFNDRSISEKGTR
LLHRSFQLEE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaccgcttttcgtacatagaggctccggtttatcaaggtcagaagaatttt
ggcacagcactgggacctgcctttctacggcagtcattgctggatcagggatttcaattt
aacacgtactccgtgcaagtatctcaatctcagaagcacatgccattttccatttatgaa
gaactgagttggttgacggaacgtgagttacgtcgcgcgaatccgatctttattgctggt
ggggaccattcgctgtcgattggttctgtgcaagggctgctacgagcagagcccgattta
aaagtgatttgggtggatgcccatggggatgtcaacacccgtgccagttccatgacaggg
tcctatcacggaatgccattggcgtatttgttaggggcagaaaatgcagatcatctaccg
tggttcacagagcgcctgaaaccacaaaatctaatttattttggagtgcgtgatttagat
caggcggaacaagagtatctagatcagcagggcatcacgtattataccgccgagcagatt
cataagactccagagaccatcatacaaaaagtttcctgtgcagttaaaggagccaaggtg
catttcagtgttgattgcgatggctttgatccgatgattgctccgtcgacaggagttcct
gtggcgcagggattacagtatcaagtggtacgcgatttaatatgtcaggtgcaatctcag
tcacaaatcgtcagttacgagtatgtcgaactcaatccacagatttttcaacaggcccac
gacgtgatggccacagcacaaatcggcatcgagttatttaaagaaattttaaatgggtac
aaaacacagggggcaattcatggtttcaatgatcgatcaattagtgaaaaagggacgcgt
ttattacaccggtctttccaattggaagagtaa

DBGET integrated database retrieval system