KEGG   Bdellovibrio exovorus: A11Q_865Help
Entry
A11Q_865          CDS       T02492                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bex  Bdellovibrio exovorus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bex00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A11Q_865
Enzymes [BR:bex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     A11Q_865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
856178..856837
Genome map
AA seq 219 aa AA seqDB search
MTSQKADQIAGEIVDICERLHRRNMLAAADGNISFRISDNEILITPSGIAKGFMKPEQMA
VISLDGKVLKGNPSSERLMHLEIFKSSEKAKAIIHAHPPTAIAWSIAQPHLDKLPSDCLS
EVILATGDIPFVPYARPGTLQMGEVLKPFLPQHRAMILRNHGAVAWGESLDEAYRGMERI
EHSAQILATAKQLGGLHPLPAEEIAYLYELRKKIGEVLL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtcaaaaagctgatcaaatcgctggcgagatcgtcgatatttgtgagcgcctt
catcgccgtaatatgttagccgccgcggacggaaatatttcttttcgtataagtgataat
gaaattttgattactccttctggaattgccaaaggctttatgaagcctgaacagatggct
gtgattagtctggatggaaaagttctaaaaggtaatccttccagtgaaagattgatgcat
cttgaaatttttaaatcttctgaaaaagccaaggcgattatccatgcgcatccacctaca
gctattgcatggtcgattgcacagcctcatttagacaagctaccaagtgattgtctatct
gaagtgattttagcaacaggtgatattccttttgttccttatgctcgtccggggacttta
caaatgggtgaagtgcttaagccatttcttccacaacatcgcgctatgattttacgtaat
catggagccgtcgcatggggtgaaagcttagatgaggcttatcgcggcatggagcgcatt
gaacattcagcgcagattttagcaacggcgaagcaactgggtggcttacatccactgcca
gcagaagaaattgcttacttgtatgagcttcgaaaaaaaatcggtgaggtattgttatga

DBGET integrated database retrieval system