KEGG   Bdellovibrio exovorus: A11Q_865Help
Entry
A11Q_865          CDS       T02492                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bex  Bdellovibrio exovorus
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bex00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
856178..856837
Genome map
AA seq 219 aa AA seqDB search
MTSQKADQIAGEIVDICERLHRRNMLAAADGNISFRISDNEILITPSGIAKGFMKPEQMA
VISLDGKVLKGNPSSERLMHLEIFKSSEKAKAIIHAHPPTAIAWSIAQPHLDKLPSDCLS
EVILATGDIPFVPYARPGTLQMGEVLKPFLPQHRAMILRNHGAVAWGESLDEAYRGMERI
EHSAQILATAKQLGGLHPLPAEEIAYLYELRKKIGEVLL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtcaaaaagctgatcaaatcgctggcgagatcgtcgatatttgtgagcgcctt
catcgccgtaatatgttagccgccgcggacggaaatatttcttttcgtataagtgataat
gaaattttgattactccttctggaattgccaaaggctttatgaagcctgaacagatggct
gtgattagtctggatggaaaagttctaaaaggtaatccttccagtgaaagattgatgcat
cttgaaatttttaaatcttctgaaaaagccaaggcgattatccatgcgcatccacctaca
gctattgcatggtcgattgcacagcctcatttagacaagctaccaagtgattgtctatct
gaagtgattttagcaacaggtgatattccttttgttccttatgctcgtccggggacttta
caaatgggtgaagtgcttaagccatttcttccacaacatcgcgctatgattttacgtaat
catggagccgtcgcatggggtgaaagcttagatgaggcttatcgcggcatggagcgcatt
gaacattcagcgcagattttagcaacggcgaagcaactgggtggcttacatccactgcca
gcagaagaaattgcttacttgtatgagcttcgaaaaaaaatcggtgaggtattgttatga

DBGET integrated database retrieval system