KEGG   Bdellovibrio exovorus: A11Q_951Help
Entry
A11Q_951          CDS       T02492                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bex  Bdellovibrio exovorus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bex00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A11Q_951
Enzymes [BR:bex01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     A11Q_951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
952313..952996
Genome map
AA seq 227 aa AA seqDB search
MSKATNKSNTTGTEIALEILTNVRPSPTVTSNLSDEEKISTIQKHFSEIMKVLGLDLEDD
SLKDTPKRMAKMYVNEIFGGLSPQNFPKITVIENKMQYDQMVCVQDIEVMSVCEHHFQPI
DGFATVAYIPKNKVIGLSKLNRIVSYFAKRPQVQERLTKQVADCLQYILDTEDVAVHINA
KHYCVISRGIQDTHSTTTTSDLRGAFKSSESTRLEFLKQCRSRFNNG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagccacaaataaatctaatacaactggaacagagatcgcattagagatctta
acgaatgttagaccatcaccgacagtaacatccaatttaagtgatgaagagaaaatctct
acaattcaaaagcatttctctgagatcatgaaagttttaggtttggatttagaagatgac
agcttaaaagatacaccgaagcgtatggcaaaaatgtacgttaatgaaattttcggtggt
ttaagtccgcaaaactttcctaaaatcacagttattgaaaataaaatgcagtacgaccaa
atggtctgcgtgcaagatattgaagtgatgtcggtttgtgaacatcactttcaacctatt
gatggttttgcaactgttgcgtatatccctaagaataaggttatcggactttcaaaatta
aatcgtattgtcagttactttgctaagcgtcctcaggtgcaggaaagactgacaaaacag
gtggcagattgcttacagtatattctggatacagaagatgtagctgtgcatatcaatgca
aaacactactgtgtaatttcccgtggtattcaagacactcatagcaccacgacaacttct
gatcttcgtggagcttttaaaagttccgagagcacacgtcttgagtttttaaagcagtgc
cgctctcgttttaataatggctag

DBGET integrated database retrieval system