KEGG   Brachybacterium faecium: Bfae_00430Help
Entry
Bfae_00430        CDS       T00965                                 

Definition
(RefSeq) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00010  Glycolysis / Gluconeogenesis
bfa00020  Citrate cycle (TCA cycle)
bfa00620  Pyruvate metabolism
bfa01100  Metabolic pathways
bfa01110  Biosynthesis of secondary metabolites
bfa01120  Microbial metabolism in diverse environments
bfa01130  Biosynthesis of antibiotics
bfa01200  Carbon metabolism
Module
bfa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bfae_00430
   00020 Citrate cycle (TCA cycle)
    Bfae_00430
   00620 Pyruvate metabolism
    Bfae_00430
Enzymes [BR:bfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bfae_00430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 8398593
NCBI-ProteinID: YP_003153517
UniProt: C7MF27
Position
41453..42796
Genome map
AA seq 447 aa AA seqDB search
MSDFRLPDLGEGLTEATIVSWHVAVGDEVTLNQALAEVETAKALVELPSPRAGRIRALHA
EEGETLAVGAPLVGFEEIAAPEAGTGQDDPADGHPADEAATAPSAAATPSDEAPAAMSST
GGGGADAPPARPERQQVLVGYGPVLPGTGRPRRRPRSFPTEPYTGRSEEEAARERPRAMP
PVRRRARDLGVDLARVHGSGPGGRILRADVDSHAGRGPARTSTRTPVTGLRRETARAMTD
SAFTAPHASVHVTVDVTDTLERLHRTERDGRRTSFLAAVCRALPPAVARTPAANAHFDAE
AAAIDVFAQVVPGIAVATERGLVVASLPELDTLDGPGLTARIAELAARAREGTLTPQELT
GSTLTVTNVGVFGVHGGTPILNPGQSTILALGAVRTQPWEHRGEVALREVVTLTVSFDHR
VLDGAEASRFLLDVAEVLADPALLLTR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacttccgactccccgacctcggcgaaggactcaccgaggcgacgatcgtgagc
tggcacgtcgccgtgggcgacgaggtcacgctgaaccaggccctcgccgaggtggagacc
gccaaggcgctcgtggagctgcccagcccccgcgccggccgcatccgcgccctgcacgcc
gaggagggcgagaccctcgccgtgggcgcgcccctggtcggcttcgaggagatcgcggca
ccagaggcgggcacggggcaggacgaccccgccgacgggcacccggccgacgaggcagcc
actgcgccctcggcggcagcgactccgtccgacgaggcgccggccgccatgtcgtcgacg
ggcgggggaggcgccgacgcgccgccggcccgtcccgagcgccagcaggtcctggtcggg
tacgggccggtgctgcccggcaccggacgcccccgccgtcggccgcgctccttcccgacg
gagccgtacaccggccgcagcgaggaggaggccgcccgcgagcggccgagggcgatgccg
ccggtgcgccgccgcgcccgcgacctcggcgtcgacctcgcccgcgtgcacggctcgggg
ccgggcggcaggatcctgcgcgccgacgtcgactcccacgccggccgcggccccgcccgc
acctccacccgcacccccgtgaccggcctgcgccgcgagaccgcgcgggcgatgacggac
tccgcgttcaccgccccgcacgcctcggtgcacgtcaccgtcgacgtcaccgacacgctc
gagcggctccaccgcaccgagcgcgacggccggcgcacctccttcctcgccgccgtgtgc
cgagcgctgcccccggccgtcgcccgcacccccgcagccaacgcccacttcgacgccgag
gccgcggcgatcgacgtgttcgcgcaggtcgtgcccgggatcgcggtcgccaccgagcgc
gggctggtggtcgccagcctcccggaactcgacaccctcgacggccccggactcaccgca
cggatcgccgagctggccgcccgcgcgagggaggggaccctcaccccgcaggagctgacc
ggctccaccctcaccgtcaccaacgtgggcgtgttcggcgtccacggcggcaccccgatc
ctcaaccccggccagagcaccatcctcgccctcggcgcggtccgcacccagccctgggag
caccgcggcgaggtcgcgctgcgcgaggtcgtcaccctcaccgtctccttcgaccaccgg
gtgctcgacggcgcggaggcctcccgcttcctgctcgacgtcgccgaggtcctcgccgat
cccgcgctcctgctgacgaggtga

DBGET integrated database retrieval system