KEGG   Brachybacterium faecium: Bfae_00520Help
Entry
Bfae_00520        CDS       T00965                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bfa  Brachybacterium faecium
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bfae_00520 (tpiA)
   01230 Biosynthesis of amino acids
    Bfae_00520 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bfae_00520 (tpiA)
   00051 Fructose and mannose metabolism
    Bfae_00520 (tpiA)
   00562 Inositol phosphate metabolism
    Bfae_00520 (tpiA)
Enzymes [BR:bfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bfae_00520 (tpiA)
Exosome [BR:bfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bfae_00520 (tpiA)
  Exosomal proteins of bladder cancer cells
   Bfae_00520 (tpiA)
  Exosomal proteins of melanoma cells
   Bfae_00520 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(51600..52442)
Genome map
AA seq 280 aa AA seqDB search
MSTLWVGTSWKMTKTLAEARTWAEGLREALAPDAASSHLTGTADSAGTAGGTGPTAGTGT
PFTRVQPFVIPSFTATTTVREILGEDSPALLGVQNAHWEEAGAWTGEVSVPQAKDAGAQI
VEIGHSERREHFGETVETTRLKVAATLRHGLTPLLCIGESAEVKEAGGSSEFILEQARGA
LDGLSAEELSRVVIAYEPIWAIGEKGRPATVEELAEPFAALGAEYGGQVTGLLYGGSVNL
DNAASLLGIEHVTGLFVGRTAWQLEGYLELLSIAEQHAAS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccctgtgggtgggcaccagctggaagatgaccaagaccctcgccgaggcgcgc
acctgggcggagggcctgcgtgaagccctcgcccccgacgccgcctccagccatctgacc
ggcacggcggacagcgccggcacggccggcgggaccggtccgacggccgggaccggcacg
cccttcaccagggtgcagcccttcgtgatcccctcgttcaccgccaccaccaccgtgcgg
gagatcctcggcgaggactcccccgcgctgctgggcgtccagaacgcgcactgggaggag
gccggcgcatggaccggcgaggtctcggtgccgcaggcgaaggacgccggcgcccagatc
gtcgagatcgggcactccgagcggcgcgagcacttcggcgagacggtggagaccacccgc
ctcaaggtcgccgccacgctgcgccacgggctcaccccgttgctgtgcatcggcgagagc
gccgaggtgaaggaggccggcggctcgagcgagttcatcctcgaacaggcccgcggagcc
ctcgacgggctctccgccgaggagctctcccgcgtggtgatcgcctacgagccgatctgg
gcgatcggcgagaagggccgccccgccacggtcgaggagctcgccgagcccttcgcagcg
ctcggcgcggagtacggcggccaggtcacgggcctgctctacggcggctccgtgaatctc
gacaacgccgcctccctgctcggcatcgagcacgtgaccggactgttcgtgggccgcacc
gcatggcagctggagggctacctcgagctgctgagcatcgccgagcagcacgccgcgagc
tga

DBGET integrated database retrieval system