KEGG   Brachybacterium faecium: Bfae_00520Help
Entry
Bfae_00520        CDS       T00965                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K21910  L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
bfa  Brachybacterium faecium
Brite
Enzymes [BR:bfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     Bfae_00520 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 8398602
NCBI-ProteinID: YP_003153526
UniProt: C7MF36
Position
complement(51600..52442)
Genome map
AA seq 280 aa AA seqDB search
MSTLWVGTSWKMTKTLAEARTWAEGLREALAPDAASSHLTGTADSAGTAGGTGPTAGTGT
PFTRVQPFVIPSFTATTTVREILGEDSPALLGVQNAHWEEAGAWTGEVSVPQAKDAGAQI
VEIGHSERREHFGETVETTRLKVAATLRHGLTPLLCIGESAEVKEAGGSSEFILEQARGA
LDGLSAEELSRVVIAYEPIWAIGEKGRPATVEELAEPFAALGAEYGGQVTGLLYGGSVNL
DNAASLLGIEHVTGLFVGRTAWQLEGYLELLSIAEQHAAS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccctgtgggtgggcaccagctggaagatgaccaagaccctcgccgaggcgcgc
acctgggcggagggcctgcgtgaagccctcgcccccgacgccgcctccagccatctgacc
ggcacggcggacagcgccggcacggccggcgggaccggtccgacggccgggaccggcacg
cccttcaccagggtgcagcccttcgtgatcccctcgttcaccgccaccaccaccgtgcgg
gagatcctcggcgaggactcccccgcgctgctgggcgtccagaacgcgcactgggaggag
gccggcgcatggaccggcgaggtctcggtgccgcaggcgaaggacgccggcgcccagatc
gtcgagatcgggcactccgagcggcgcgagcacttcggcgagacggtggagaccacccgc
ctcaaggtcgccgccacgctgcgccacgggctcaccccgttgctgtgcatcggcgagagc
gccgaggtgaaggaggccggcggctcgagcgagttcatcctcgaacaggcccgcggagcc
ctcgacgggctctccgccgaggagctctcccgcgtggtgatcgcctacgagccgatctgg
gcgatcggcgagaagggccgccccgccacggtcgaggagctcgccgagcccttcgcagcg
ctcggcgcggagtacggcggccaggtcacgggcctgctctacggcggctccgtgaatctc
gacaacgccgcctccctgctcggcatcgagcacgtgaccggactgttcgtgggccgcacc
gcatggcagctggagggctacctcgagctgctgagcatcgccgagcagcacgccgcgagc
tga

DBGET integrated database retrieval system