KEGG   Brachybacterium faecium: Bfae_01690Help
Entry
Bfae_01690        CDS       T00965                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bfa  Brachybacterium faecium
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bfae_01690
   00051 Fructose and mannose metabolism
    Bfae_01690
Enzymes [BR:bfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Bfae_01690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
190018..191211
Genome map
AA seq 397 aa AA seqDB search
MTAPTPTRDDKFSFGLWTTGWQAQDQFGSATRPPLDLTDHVRKLADLGAWGFTFHDNDVV
PFDATPAERERILGELKKVTEETGLVIEMVTTDTFAHPVFKDGAFTSNDRSVRRFGLRKV
LANVDLAAELGATTFVMWGGREGSEYDGSKDLLAAHQRYAEGIDTVAGYIKDKGYDLRIG
LEPKPNEPRGNIFLPTIGHALAFIEQLEHGDIVGINPETGHEQMATLNYTHGIAQALWAE
KLFHIDLNGQHGPMYDQDLVFGHGDLISAFFTVDLLENGFPSKPGAYEGARHFDFKPSRT
EHEKGQYDSAAANMEMYLMLKERALAFRADAEVQEALKYSGIEELAEPTLAAGETVTDLL
ADRSSFEDFDADKAGERNYGFVRLQQLALQHLLGFRA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacccacccccacccgtgacgacaagttctccttcggcctgtggaccaccggc
tggcaggcccaggaccagttcggctccgccacccgcccgccgctggacctcaccgaccac
gtgcgcaagctcgccgacctcggcgcctggggcttcaccttccacgacaacgacgtggtg
cccttcgatgccacccccgccgagcgcgagcgcatcctcggcgagctgaagaaggtcacc
gaggagaccggcctggtgatcgagatggtcaccaccgacaccttcgcccaccccgtcttc
aaggacggcgccttcacctccaacgaccgctccgtgcgccgcttcggcctgcgcaaggtg
ctcgccaacgtggatctcgccgctgagctcggcgcgaccaccttcgtgatgtggggcggg
cgcgagggctccgagtacgacggctccaaggacctgctggccgcgcaccagcgctacgcc
gagggcatcgacaccgtcgccggctacatcaaggacaagggctacgacctgcgcatcggc
ctcgagcccaagccgaacgagccccgcggcaacatcttcctgcccacgatcggccacgcg
ctggccttcatcgagcagctcgagcacggcgacatcgtgggcatcaaccccgagaccggc
cacgagcagatggcgacgctgaactacacccacggcatcgcccaggcgctgtgggcggag
aagctcttccacatcgacctcaacggccagcacggcccgatgtacgaccaggacctcgtg
ttcggccacggcgacctgatcagcgccttcttcaccgtggacctgctcgagaacggcttc
ccctcgaagccgggcgcctacgagggtgcccgccacttcgacttcaagccctcgcgcacc
gagcacgagaagggccagtacgactcggccgccgcgaacatggagatgtacctgatgctc
aaggagcgcgccctcgcgttccgtgccgacgccgaggtccaggaagcgctgaagtactcc
ggcatcgaggagctcgccgagccgaccctcgctgcgggcgagaccgtcaccgacctcctc
gccgatcgctcctccttcgaggacttcgacgcggacaaggcgggcgagcgcaactacggc
ttcgtgcgcctgcagcagctggccctccagcacctgctcggcttccgcgcctga

DBGET integrated database retrieval system