KEGG   Brachybacterium faecium: Bfae_02740Help
Entry
Bfae_02740        CDS       T00965                                 

Definition
dTDP-4-dehydrorhamnose reductase
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bfa  Brachybacterium faecium
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:bfa00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bfa00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
315474..316913
Genome map
AA seq 479 aa AA seqDB search
MTELAVRTTPIPGLLVIDLPVHGDPRGWFKENWQREKMLAAGLPDLGPVQNNISFNQTVG
VTRGIHAEPWDKYISVATGRVFGAWVDLRRGPSFGATYWHEITPDIAIYVPRGVGNAFQT
LEAPAAYTYLVNAHWSAAAQEQYTFLHLADETAAIPWPIPLEQAELSAKDRAHPLLADVA
PVPPRRTLVVGGGGQLGRALAAWWSRRGDVDVVAREHLDIADARSVAAFDFAPYGTIVNA
AACTAVDASEAPEGRRTAWAVNVTGVGHLVEAARAHRATLVHVSSDYVFDGTIEVHGENE
PPSPLGVYGQTKAAGDQLVATLPDHYIVRTSWVIGEGRNFVATMAALAERGIDPAVVDDQ
IGRLTFTEDLAAAIDHLLVARPAPGIYNVTGEGEPASWAGIAAEVFALSGHDPHRVTPVS
TAEYYAGKDGIAPRPAHSTLDLAKIRATGFVPLDQLTALRDHLSSSHPAAPAEARLAAS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctcgccgtccgcaccacgcccatccccgggctgctggtgatcgacctgccc
gtgcacggcgatccgcgcggctggttcaaggagaactggcagcgggagaagatgctggcc
gccgggctgccggatctcggtccggtgcagaacaacatctccttcaaccagaccgtgggc
gtcacgcgcgggatccacgccgagccgtgggacaaatacatctctgtcgcgaccggcagg
gtgttcggcgcatgggtcgacctgcgccgcgggccgagcttcggcgcgacgtactggcac
gagatcacgcccgatatcgcgatctacgtgccgcgcggagtgggcaacgccttccagacc
ctcgaggctccggccgcctacacctacctcgtcaacgcccactggtccgcggcggcgcag
gagcagtacacgttcctgcacctggccgacgagaccgccgccatcccgtggccgatcccg
ctcgagcaagcggagctctcagccaaagaccgcgcgcacccactgctcgcggacgtggcg
ccggtgcccccgcgccgcaccctcgtcgtcggcggaggcgggcagctcggccgggccctg
gccgcgtggtggtcgcgccgaggtgacgtcgacgtcgtcgcccgggagcacctcgacatc
gccgatgcgagaagcgtcgccgctttcgatttcgcgccctacgggacgatcgtcaacgcc
gccgcctgcaccgcggtggacgcctccgaggctcccgagggccgacgcaccgcctgggcg
gtcaacgtcaccggcgtcggccatctggtggaggccgcccgcgcccaccgcgccaccctc
gtccacgtctccagcgactacgtcttcgacggcaccatcgaggtgcacggcgagaacgag
ccgcccagcccgctgggtgtgtacggccagaccaaggctgccggcgaccagctcgtcgcg
accctcccggaccactacatcgtgcgcaccagctgggtgatcggcgaagggaggaacttc
gtggccaccatggcagctctcgccgagcgcgggatcgacccggcggtggtcgacgaccag
atcggcaggctcaccttcaccgaggatctcgccgccgcgatcgaccacctgctcgtggca
cgtcccgccccgggcatctacaacgtcaccggagagggggagccggccagctgggcaggg
atcgccgccgaggtgttcgcgctgtccggtcacgacccgcaccgggtgacccccgtgagc
accgccgagtactacgccggcaaggacggcatcgccccgcgcccggcgcactcgacgctc
gacctcgcgaagatccgcgctaccggattcgtcccgctggaccagctcactgcgctgcgg
gaccatctgagctcctcccaccccgcagcccccgcggaggcccgtctcgcggcctcctga

DBGET integrated database retrieval system