KEGG   Brachybacterium faecium: Bfae_03450Help
Entry
Bfae_03450        CDS       T00965                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bfa  Brachybacterium faecium
Brite
Enzymes [BR:bfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Bfae_03450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(400849..402000)
Genome map
AA seq 383 aa AA seqDB search
MKRRQILTATAVATAATLGTAATASAAPGNGEHTPPGLAKKDTLAWAAGGVIEIGSAVAG
GGHHTEQDYPTPMSEEIYRETLGREVTSLSAENQMKWDYLRPDRETFDFEDADEIMDFAQ
QHGQVVRGHTLLWHAQNPTWLEEGDFSADELRDLLKEHIDTVVGRYRGRIQQWDVVNEIF
TDEGELRLNDNIWLRELGPGILADAFRWTRAADPDALLFFNDYNVDGVSAKSDAYYALIT
ELLAEGVPIDGFSTQGHLSLRYDFPEDITENLQRFADLGLETAITELDVRMDLEEGATPT
EQQLEQQADYYRRMTEAALSVEGCNSLTLWGFPDVYSWVPGTFEGEGAATVLWDDYTRKP
AYYAVQDALAEASGRAGHPALRR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgccgccagatcctcaccgccaccgctgtcgccaccgccgccacgctgggcacc
gccgccacagcgtccgccgcgccgggcaacggggagcacacaccgcccggcctcgccaag
aaggacaccctggcctgggccgccggcggggtgatcgagatcggctccgccgtcgccggc
gggggccaccacaccgagcaggactacccgacgccgatgagcgaggagatctaccgcgag
accctcggccgcgaggtcacctcgctctcggcggagaaccagatgaagtgggactacctg
cgaccggaccgcgagaccttcgacttcgaggatgcggacgagatcatggacttcgcccag
cagcacggacaggtggtgcgcggccacaccctgctgtggcacgcccagaaccccacctgg
ctcgaggagggcgacttctccgcggacgagctgcgcgacctgctcaaggagcacatcgac
accgtcgtcggccgctaccgcgggcgcatccagcaatgggacgtggtcaacgagatcttc
accgacgagggcgagctgcgcctgaacgacaacatctggctgcgcgagctgggccccggg
atcctcgccgacgccttccgctggacccgcgccgcggaccccgacgcgctgctgttcttc
aacgactacaacgtcgatggcgtgagcgcgaagtccgatgcgtactacgcgctgatcacc
gagctgctcgccgagggcgtcccgatcgacgggttctccacccagggccacctctcgctc
cgctacgacttccccgaggacatcacggagaacctccagcgcttcgccgacctgggcctg
gagaccgcgatcaccgagctggacgtgcgcatggacctcgaggagggcgccacgcccacc
gagcagcagctggagcagcaggccgactactaccggcgcatgacggaggcggccctgtcc
gtcgagggctgcaactccctgaccctgtggggcttcccggacgtgtactcctgggtgccg
ggcaccttcgagggcgagggcgccgcgaccgtgctgtgggacgactacacccgcaagccc
gcctactacgccgtgcaggacgcgctcgcggaggccagcggccgcgccgggcatcccgcg
ctgcgccgctga

DBGET integrated database retrieval system