KEGG   Brachybacterium faecium: Bfae_05010Help
Entry
Bfae_05010        CDS       T00965                                 

Definition
family 4 glycosyl hydrolase, alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bfa  Brachybacterium faecium
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bfae_05010
  Lipid metabolism
   00561 Glycerolipid metabolism
    Bfae_05010
   00600 Sphingolipid metabolism
    Bfae_05010
Enzymes [BR:bfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Bfae_05010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
572144..573532
Genome map
AA seq 462 aa AA seqDB search
MTTTHLKNPKITIIGAGGFVFPFRLIGDILSFPALRDSALTLMDIDPDKLGPVASATREL
VAHHGFGATVEETTDRRAALDGADIVIITFQVGGVESYRHDVEIPRKYGIDQTVGDTVGP
GGVFRFLRSVPAYDEIAADALEVCPEATFINYANPMAMATAYLNAKGLRTVGLCHSVQGT
TRMLARTLGVPYEEVSYRCAGINHQAWILEFMHGQQDLYPQMREVMAATHQRGRGAANLA
GDDGDHSEVADGANVYEGGNEQVRTSIMNAFGYFQTESSHHASEYLPYFRKNPQLVEEFI
PERWDYYEICVSHDDQGDIDAQLERLKTELAPSVEYGAQIANSIVSGTPSVVHGNVPNAG
ALITNLPDDACVEVPCLVDARGVQPTAIGDLPPQLAALNRTNVNVQTLAVRAALEGEVEN
VHHAVALDPLTAALLTLEDARAMTDELLAAHADGLPEALRMG
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacgcatctgaagaaccccaagatcacgatcatcggcgccggcgggttcgtg
ttccccttccgcctcatcggcgacatcctctccttccccgccctcagggactcggccctc
accctgatggacatcgacccggacaagctcggcccggtcgcgagcgcaacccgcgagctc
gtcgcccaccacggcttcggagcgacggtcgaggagaccaccgaccgccgcgcggcgctg
gacggcgcggacatcgtgatcatcaccttccaggtgggcggggtggagtcctaccggcac
gacgtggagatcccgcgcaagtacgggatcgaccagaccgtgggcgacaccgtggggccc
ggcggcgtgttccgcttcctgcgctcggtgcccgcctatgacgagatcgcggccgacgcc
ctcgaggtgtgcccggaggccaccttcatcaactacgccaaccccatggcgatggccacc
gcgtacctgaacgcgaaggggctgcgcaccgtggggctgtgccacagcgtgcagggcacc
acccgcatgctcgcccgcaccctcggcgtcccctacgaggaggtctcctaccgctgcgcc
ggcatcaaccaccaggcctggatcctcgagttcatgcacggccagcaggacctctacccg
cagatgcgtgaggtgatggccgcgacgcaccagcgcggtcgcggcgccgcgaacctcgcc
ggcgacgacggcgaccactccgaggtggccgacggcgcgaacgtgtacgagggcggcaac
gagcaggtgcgcacctccatcatgaacgccttcggctacttccagaccgaatccagccac
cacgcctcggagtacctgccctacttccgcaagaacccgcagctcgtggaggagttcatc
cccgagcgatgggactactacgagatctgcgtgtcccacgacgaccagggcgacatcgac
gcccagctcgagaggctcaagacagagctcgccccgagcgtcgagtacggcgcgcagatc
gcgaactcgatcgtcagcggcacccccagcgtggtgcacggcaacgtgcccaacgccggc
gccctcatcacgaacctgccggacgacgcctgtgtggaggtgccctgcctggtcgacgcc
cgcggcgtgcagcccaccgccatcggtgacctcccgccgcagctcgccgcgctgaaccgc
accaacgtcaacgtgcagaccctcgccgtgcgggcagcgctcgagggcgaggtggagaac
gtgcaccacgccgtggcgctcgacccgctgaccgccgccctgctcaccctcgaggacgcc
cgggcgatgaccgacgagctgctcgccgcgcacgcggacgggctgccggaggcgctgcgc
atgggctga

DBGET integrated database retrieval system