KEGG   Brachybacterium faecium: Bfae_05380Help
Entry
Bfae_05380        CDS       T00965                                 

Definition
restriction endonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
bfa  Brachybacterium faecium
Brite
Enzymes [BR:bfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Bfae_05380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
622425..625430
Genome map
AA seq 1001 aa AA seqDB search
MGDNTASSGFKFDASQPYQLDAIKSVVDLFDGQPKDAEKLETTLRGRVAAVNSSDNTTLD
LDLSQEVGAVGNRLVLDRDTVLANLQRVQDKNGLEVASKLFDDSALDFDIEMETGTGKTY
VYLRTIFELAEKYNFTKFVILVPSVAIREGVNTSIRLMRSHFENLYKKRNITFDSSVYSG
KTAEEVQSFATSTNVQIMVMTIDSIRGNAATRIIHQTRDKLNGLKPIDYLKATHPVVIMD
EPQNMESRLSQSAVSELDPVFTLRYSATHKKLRNVVYRLDPVDAHDLGLVKQIVVADVQQ
QGADATPYIKLVEVKNDKGWVARLELSCRKADGSLERRVVNVKQNQELSDPRLTNNASYD
GWRVNEMSIEPAYVDLTLHGYLYQGESIGGSSGAIYKEMIRETIKEHLRKETQLRAKGIK
VLSLFFIDKVESFLGDGSNNLDANGQFVQWFDELFREERAKSPQWQELLPQDPAELRRGY
FSVLKGKKGAADRFQDTSGTTKADDDAYELIMQQKERLLDENEPTRFVFSHSALREGWDN
PNVFQICTLREMGAETERRQTLGRGLRLPVAKSEGGYERVADRGIATLTVVANESYKQFA
DALQKEYKDAGVEIGRVRKAEFSKIPLQNPDGSLTDENLGYEGSVSIWEHLLAQKFIDKD
GVVQPKFQPNIEGFSLNMPADFMWAEPFVIELVGRAHIGKYVKPKSKRHSRRLNKELFAN
PEFEKFWETISRRTTYRVEVERDKIIENSVRAIKEAPDIDPLRIQVTRAGVKVLRGGAKG
QELGSRQQELRGSYDLPDIIGELQEATSLTRKTIVDVLVGSGRLGEFIANPNDFIAMAKR
LMQTELAKLVVDGVQYEKIAGSVYELRELRKDGEEEKERFLDQMYKLENADKSNFDYVVY
DSDPERQFAELLDGREDIKFFMKLPDRFKIDTPVGPYNPDWAIVKHEDGEERVYMIRETK
STEDEIKRRPTENAKIRAAKHHFEAIGVPDYAVSVPGRWRL
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgggagacaacacagcgagcagcggattcaagttcgacgcgagtcagccctaccagctc
gacgcgatcaagtctgtcgtcgacctgttcgacggacagccgaaggatgccgagaagctg
gagacgacgctgcgcggccgggtagctgctgtcaactcaagcgataacacgacgctcgac
ctcgacctctcgcaggaggtcggcgccgtcggtaaccgcctagtgctcgaccgcgacacg
gtgctcgccaacctgcagcgtgtgcaggacaagaacggcctcgaggttgcctcgaagctg
ttcgacgactctgcgctcgatttcgatatcgagatggagacgggtacgggcaagacgtac
gtgtacctccgcaccatcttcgaactggccgagaagtacaacttcacgaagttcgtcatc
ctcgtgccgagcgttgcgatccgtgagggcgtgaacacgagcatccggctcatgcgttcg
cacttcgagaacctgtacaagaagcgcaacatcaccttcgactcgtcggtctacagtggt
aagacggccgaggaggtgcagtcgttcgcgacgtcgaccaacgtgcagatcatggtcatg
acgatcgactcgatccgtggcaacgcggcgactcgcatcatccaccagacgcgggacaaa
ctgaacggtctcaagccgatcgactacctgaaggcgacgcatccggtcgtcatcatggac
gagccgcagaacatggagtccaggctctctcagtcggccgtgagcgagctcgacccggtg
tttacgctgcgctatagcgcgacgcacaagaagctccgcaacgtcgtctaccgactcgat
ccggtcgacgcgcacgatctaggtctggtgaagcagatcgtggtggcggacgtgcagcag
caaggtgcggacgcgacgccgtacatcaagctggtcgaggtcaagaacgacaagggctgg
gttgcccggctggagctgtcctgccggaaggctgacggttcgctcgagcggcgcgtggtg
aacgtcaagcagaatcaggagctgtccgatcctcgcctgacgaacaacgcgagctacgac
ggctggcgcgtcaacgagatgagtatcgagcccgcgtacgtcgacctgacgctgcatggc
tatctgtaccagggcgagagcatcggcggatcgtcgggtgcgatctacaaggagatgatt
cgcgagacgatcaaggagcacctgcgcaaggagacgcaactgcgcgctaagggcatcaag
gtgctcagcctgttcttcatcgacaaggtggagagcttcctcggtgacggctcgaacaat
ctcgatgcgaacggtcagttcgtgcagtggttcgacgagctgttccgtgaggagcgtgcc
aagtcgccgcagtggcaggagctgctcccgcaggatccggccgagctgcgtcgcggctac
ttctctgtcctcaagggcaagaagggcgcggcggacaggttccaggacacgtccggcacg
accaaggccgacgatgacgcgtacgagctgatcatgcagcagaaggaacggctgctcgac
gagaacgagccgacgcggttcgtgttcagccactctgccctgcgcgagggctgggacaac
ccgaacgtcttccagatctgcaccctgcgcgagatgggcgccgagacggagcgacgccag
acgctcgggcgtggtctacgtctgccggtcgcgaagagcgagggcggctacgagcgtgtg
gccgatcgtggcatcgcgacgttgacggtggttgcgaacgagtcgtataagcagttcgcc
gatgcgctccagaaggagtacaaggacgcgggtgtcgagatcgggcgtgtgcgcaaggcg
gagttctcgaagatcccactgcagaaccctgacggttcgcttaccgatgagaacctcggc
tacgagggctccgtgtcgatctgggagcacctgctcgcgcagaagttcatcgacaaggac
ggcgttgtgcagccgaagttccagccgaacattgagggtttcagcctcaacatgcctgca
gatttcatgtgggccgagccgttcgtcatcgagctggtcggccgcgcccacatcggtaag
tacgtcaagccgaagagcaagcgacactcgcgcaggctcaacaaggagctgttcgcgaac
ccggagtttgagaagttctgggagacgatcagccgccgcaccacgtaccgcgtcgaggtg
gaacgcgacaagatcattgagaactcggtcagagcgatcaaggaagcaccggacatcgat
ccgttgcgcatccaggtcacccgcgcgggcgtgaaggtgctccgtggcggcgcgaagggt
caggaactcgggtcacgtcaacaggaactccgaggcagctacgacctgcccgacatcatc
ggggagctgcaggaggccacttccctcacccgcaagaccattgtcgacgtcctcgtcggc
agcggccggctgggcgagttcatcgcgaacccgaacgacttcatcgctatggccaagcgc
ctcatgcagaccgagctcgcgaagctcgtcgtcgacggcgtgcagtacgagaagatcgca
ggttctgtctacgagctgcgtgaactgcgcaaggacggcgaagaggagaaggaacgcttc
ctcgaccagatgtacaagctggagaacgcggacaagtcgaacttcgactacgtcgtctac
gactccgaccctgagcgccagttcgcggaactgctcgacggccgcgaggacatcaagttc
ttcatgaagctgcccgacaggttcaagatcgacaccccggtcggcccgtacaacccggac
tgggcgatcgtgaagcacgaggacggcgaggagcgcgtgtacatgatccgagagacgaag
agcacggaagacgagatcaagcgccgcccgacagagaacgccaagatccgggcagccaag
caccacttcgaggcaattggcgtgccggactacgcggtctcagttccgggtcggtggagg
ctgtga

DBGET integrated database retrieval system