KEGG   Brachybacterium faecium: Bfae_06120Help
Entry
Bfae_06120        CDS       T00965                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bfa  Brachybacterium faecium
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bfa00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
708969..709568
Genome map
AA seq 199 aa AA seqDB search
MSRLLIIVDAQNDFCEGGALGVDGGAAVAGRIAAFVREHGAQYDRIFASQDWHRGDTDNG
GHFAVPPAEPDFTDTWPVHCVAGTEGAALHAEVAALAEELGERLEIVHKGHGIPSYSVLE
GTVVATDEGVEHLIAAGGWDRIDVVGLAYDFCVRATALGATEAGAPVRVLSDLTAAVHPA
DIPALEEELRGAGVEVTAS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcctgctgatcatcgtcgatgcccagaacgacttctgcgagggcggtgcgctc
ggcgtcgacggcggcgccgcggtcgcgggacggatcgccgcgttcgtgcgggagcacggg
gcgcagtacgacaggatcttcgccagccaggactggcatcgcggggacacggacaacggc
ggtcacttcgccgtgccgccagcggagccggacttcaccgacacctggccggtgcactgc
gtcgccggcaccgagggggcggcgctgcacgccgaggtggcggcgctcgccgaggagctg
ggggagcggctggagatcgtgcacaaggggcacgggatcccctcctacagcgtgctcgag
ggcaccgtcgtcgcgaccgacgagggggtggagcacctgatcgcggccgggggctgggac
cggatcgatgtggtgggcctggcctatgacttctgtgtgcgcgccaccgcgctcggcgcc
accgaggccggtgcgccggtccgcgtgctgagcgacctgaccgccgccgtgcaccccgcc
gacatccccgcgctcgaagaggagctgcggggcgccggagtggaggtcaccgcctcctga

DBGET integrated database retrieval system