KEGG   Brachybacterium faecium: Bfae_08090Help
Entry
Bfae_08090        CDS       T00965                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bfa  Brachybacterium faecium
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bfae_08090
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Bfae_08090
Enzymes [BR:bfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bfae_08090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(918523..919788)
Genome map
AA seq 421 aa AA seqDB search
MGPAYGGAREPGSAWNTGGMRRRHLLALAPAAALAACTAQEPADGPDTDGPSDAGGGDGG
TDGTSSPTEPSTAATTEPPTAAELLLEELSPRELAGQLVLVGIPAGSEIPAAALEEHHAG
GIFLLQVWESADAVDRTVAAARDRSRDDLPPLIAVDQEGGQVRMLRGEAARRTPSAEELG
AQGPGAVTEAYTSIGEDLAARGIQVALSPVADVVDPDLGDANEPVGAVDRGFGTEPGPVG
ECVVAATEALAAQGVAATLKHFPGLGRVEQNTDFSAEGIEDDVTGPEDPFLDSFRDGIDA
GAPLVMMSSAVYPRLEPEVPAMFSAAAIQDLLRDGLGFSGLVVSDDIGAAEAVAAVPVPE
RATRLLEAGGDVVLTADASLTGELVDAIEEFASRGEEQAQRVRESAGRMLALKEQLGLLG
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgggcccagcctacgggggcgcgcgcgagccggggtccgcgtggaacactggcggcatg
agacgtcgtcatctgctggccctcgcccctgccgcagccctggccgcctgcacggcccag
gagccggcggacggccccgacaccgacgggccgagcgatgcgggaggcggcgacgggggc
accgacgggaccagctccccgacggagccgagcaccgcggccacgaccgagccgcccacc
gcggcggagctcctgctcgaggagctctccccgcgcgagctcgccgggcagctggtgctg
gtcggcatcccggccggcagcgagatccccgcagcggcgctcgaggagcaccatgccgga
gggatcttcctgctgcaggtgtgggagagcgccgacgccgtcgaccgcactgtcgccgcc
gcccgcgaccgctcccgggacgacctcccgccgctgatcgcggtggaccaggagggcggc
caggtgaggatgctgcgcggggaggccgcgcgccgcaccccctcggccgaggagctcggc
gcccagggccccggggccgtcaccgaggcgtacacgagcatcggcgaggatctggccgcc
cgcggcatccaggtcgccctctcccccgtcgcggacgtggtcgatcccgacctcggcgac
gccaacgagcccgtcggcgcggtggaccgcggcttcggcaccgagccggggccggtgggc
gagtgcgtggtcgcggcgacggaggcgctcgcggcgcagggcgtggcggcgaccctcaag
cacttcccgggcctgggccgggtcgagcagaacaccgacttctccgccgaggggatcgag
gacgacgtcaccggccccgaggatcccttcctcgactccttccgcgacgggatcgacgcc
ggggcgccgctggtgatgatgtcctcggcggtctatccgcgcctcgagccggaggtgccg
gcgatgttctccgccgccgcgatccaggacctgctgcgcgacgggctgggcttctccggg
ctcgtcgtctccgatgacatcggcgcggcggaggccgtcgccgcggtgccggtgccggag
cgcgccacccgcctgctcgaggccggcggcgacgtggtgctcacggccgacgcctccctc
accggcgagctggtcgatgcgatcgaggagttcgcctcgcggggcgaggagcaggcgcag
cgggtgcgggaatccgccgggcgcatgctcgcgctcaaggagcagctggggctgctcggc
gactag

DBGET integrated database retrieval system