KEGG   Brachybacterium faecium: Bfae_08250Help
Entry
Bfae_08250        CDS       T00965                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
bfa  Brachybacterium faecium
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bfae_08250
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Bfae_08250
Enzymes [BR:bfa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Bfae_08250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(942722..943666)
Genome map
AA seq 314 aa AA seqDB search
MTDILDKPSTHRSDSASPPNEAEIVLGPTQYGKAETHVVRITRGTPRHEIRDVTVTSQLR
GDLEAMHSEGDNAHCVATDTQKNTVFGFAQTHGVKSPEQLLLALSDHFTSEFEWIHGGRW
EAEEHAWERIDDHDHCFVESKQEKRTAVVVTDGEKRTVISGFYDLTVLKSTGSGFEGYPK
DRFTTLQETQDRILSTDIATRWRYSTTDVDFDEVYRSVKKILLSKFTDHYSRALQETLHH
MGSAVLTAHPEIDEIKFSCPNKHHFVYDLGFAGIENNLETHHAADRPFGLIEATLQRKGA
PTADDAWMGINGFC
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctcgacaagccttcgacccaccgctccgactccgcgagccccccgaac
gaggccgagatcgtcctcggacccacccagtacggcaaggcggagacgcacgtcgtgcgc
atcacgcgcggtacgccgcgccacgagatccgggacgtcaccgtcacctcgcaactgcgc
ggtgacctggaggcaatgcattccgagggcgacaacgcccactgcgtcgccaccgacacc
cagaagaacaccgtgttcggcttcgcccagacccacggcgtgaagtcgcccgagcagctc
ctgctggcgctctcggaccatttcacctcggagttcgagtggatccacggcggccgctgg
gaggccgaggagcacgcctgggagcggatcgacgatcacgatcactgcttcgtcgagtcg
aagcaggagaagcgcaccgcggtggtggtcaccgacggcgagaagcgcacggtgatctcc
ggcttctacgatctgaccgtcctgaagtccaccggatccggcttcgagggatacccgaag
gatcggttcacgaccctgcaggagacccaggatcgcatcctctcgaccgacatcgcgacc
cgctggcgctacagcaccacggatgtcgacttcgatgaggtctaccgcagcgtgaagaag
atcctcctgtcgaagttcaccgatcactactcccgtgcgctgcaggagaccctccaccac
atgggcagcgccgtgctcacggcccacccggagatcgacgagatcaagttctcctgcccc
aacaagcaccatttcgtgtacgacctcggcttcgccggcatcgagaacaacctcgagacg
caccacgcggcggaccgccccttcggcctcatcgaggccactctccagcgcaagggggcc
cccacggccgacgatgcctggatgggcatcaacggattctgctga

DBGET integrated database retrieval system