KEGG   Brachybacterium faecium: Bfae_08320Help
Entry
Bfae_08320        CDS       T00965                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bfa  Brachybacterium faecium
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bfae_08320
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bfae_08320
   00052 Galactose metabolism
    Bfae_08320
   00500 Starch and sucrose metabolism
    Bfae_08320
   00520 Amino sugar and nucleotide sugar metabolism
    Bfae_08320
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bfae_08320
   00524 Butirosin and neomycin biosynthesis
    Bfae_08320
Enzymes [BR:bfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bfae_08320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(948999..949955)
Genome map
AA seq 318 aa AA seqDB search
MPDPVLALDLGGTKIRAALVHEGEGGSTPRLEHVAEVATPATSGPAAILGAALDLAAQVA
AGTAVRAVGLSSAGVIDSGRGRVTHATSSLTGWAGTDVLTPFAERFGVPVSVLNDVHAHG
LGEARCGVGRGRSSLLLVAVGTGIGGCHVLGGHAVVGAHGAAGHVGHLPVPEAEGIPCPC
GRSGHLEGLASGPGIVQLAARLGADPSLREGRALAAAAAAGDETAREAYRVAGHATGRVL
GGLLNVLDPEVVALTGGVAEAGAGWFEAVTRGIAQEAMDVVADTAVLPASAGSHAALLGA
AARALEELSSPAPHSPSR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatcccgtcctcgccctcgacctcgggggcacgaagatccgcgccgccctggtc
cacgagggcgagggcggctcgacgccccgcctcgagcacgtcgccgaggtcgcgaccccg
gcgacctcggggcccgcggcgatcctcggcgccgccctcgacctcgccgcgcaggtggcc
gccggcaccgccgtgcgggccgtggggctctcctcggccggggtgatcgacagcggccgc
ggccgcgtcacccacgccacctcctcgctgaccggctgggcgggcacggacgtgctcacc
ccgttcgcggagcggttcggcgtgcccgtcagcgtgctgaacgacgtgcacgcccacggc
ctcggcgaggcccgctgcggtgtgggccgcgggcgctcctccctgctgctggtcgcggtg
ggcaccggcatcggcggctgccacgtgctcggcggccacgccgtcgtcggcgcccacggg
gcggccggtcacgtgggccacctgccggtgccggaggccgaggggatcccctgcccgtgc
gggcgcagcggccacctcgagggcctcgcctccgggccgggcatcgtgcagctcgccgcc
cggctcggcgccgatccctcgctgcgggagggccgggccctcgccgcggccgccgcggcg
ggggacgagaccgcccgcgaggcgtaccgcgtggcgggccacgccaccggccgcgtcctc
ggagggctgctgaacgtgctggatcccgaggtcgtggcgctcaccggcggggtggccgag
gccggcgccggctggttcgaggcggtcacgcgcggcatcgcgcaggaggcgatggacgtc
gtcgccgacaccgccgtgctgccggcgagcgccggctcccacgccgcgctgctgggcgcc
gccgcccgcgccctcgaggagctctcctcccccgccccacactccccgtcccgctga

DBGET integrated database retrieval system