KEGG   Brachybacterium faecium: Bfae_08870Help
Entry
Bfae_08870        CDS       T00965                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bfa  Brachybacterium faecium
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bfae_08870
   01230 Biosynthesis of amino acids
    Bfae_08870
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bfae_08870
  Energy metabolism
   00680 Methane metabolism
    Bfae_08870
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bfae_08870
Enzymes [BR:bfa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bfae_08870
Exosome [BR:bfa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bfae_08870
  Exosomal proteins of melanoma cells
   Bfae_08870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1007900..1008646)
Genome map
AA seq 248 aa AA seqDB search
MTYTLVLLRHGESDWNAKNLFTGWVDVHLTEKGRQEAVEGGDLLKEAGILPDVVHTSLQR
RAIMTANLALDAADRHWIPVKRDWRLNERHYGALQGMDKAEIREKYGEEQFMAWRRSYDT
PPPEIELGSEFSQDQDPQYADLGDQLPKSECLKDVVERFLPYWEEGITPDLREGKTVLIA
AHGNSLRALVKYLDGISDEEISGLNIPTGQPLIYELDEDFQPVEKGGRYLDPVAAKAAAE
AVANQGKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacctacacactcgtgctgctccgccacggcgagagcgactggaacgccaagaacctg
ttcaccggctgggtggacgtgcacctcaccgagaagggccgccaggaggccgtcgagggc
ggcgacctgctgaaggaggccgggatcctgccggacgtggtgcacacctcgctgcagcgc
cgcgccatcatgaccgcgaacctcgccctggacgccgcggatcgtcactggatccccgtc
aagcgcgactggcgcctcaacgagcgccactacggcgccctgcagggcatggacaaggcc
gagatccgggagaagtacggcgaggagcagttcatggcctggcgccgctcctacgacacc
ccgccgccggagatcgagctcggcagcgagttctcgcaggatcaggacccgcagtacgcc
gatctcggtgaccagctgccgaagtccgagtgcctcaaggacgtcgtggagcgcttcctg
ccgtactgggaggagggcatcacgccggatctgcgcgagggcaagaccgtgctgatcgcc
gcgcacggcaactcgctgcgcgcgctggtgaagtacctcgacggcatctccgacgaggag
atctccgggctcaacatccccaccggccagccgctgatctacgagctcgacgaggacttc
cagcccgtcgagaagggcggccgctacctcgacccggtcgccgcgaaggccgccgccgag
gccgtcgccaaccagggcaagaagtga

DBGET integrated database retrieval system