KEGG   Brachybacterium faecium: Bfae_10760Help
Entry
Bfae_10760        CDS       T00965                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bfa  Brachybacterium faecium
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bfa00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bfa00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1208338..1209915
Genome map
AA seq 525 aa AA seqDB search
MTPIVENTPEPARPRHPHGATAAELARALGAAAPEEDLALRGVSLDSRSVEPGDLWCALP
GATAHGAEFAAQAAGRGAAMALTDPAGRERCEAAGLPALVVDDPRSATALAAALVHGRPA
ERLATIGVTGTNGKTSVTTAITRALLELGVPAGAIGTSGTSYRAADGSDHAIATVRTTPE
APELHGLLARMAEDGVEVVSMEVSSHALVLHRADEVVYDVVCFTNLTQDHLDFHGTMEAY
YEAKRTLFTPAHARRGVVCVDDDWGRRLAREAQIPVTTYATRPGIDADHRAREHRADGYG
SIVEVDGPDGTRTLHAALPGRHYVANTLAADLLLAAIGRTGEDVVQALGEAGTVPGRMEP
VAHTPIRGVVDYSHTPDALEQALLTLRAVPGTGRLLVVMGAGGDRDRAKRPLMGEVAARY
ADVVLVTDDNPRTEDPAAIRAEVLSGIPEGTKAQVHDVDGRGEAIALAAYLADVSDTILV
AGKGAETGQQIGGIVHPFDDRLRLRDALRDAQPARGGADDLDEGR
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccgatcgtggagaacacccccgaacctgcccgcccgcgccacccgcacggcgcg
acggcggcggagctggcccgcgccctcggcgccgcggcccccgaggaggatctcgccctg
cggggcgtgagcctcgattcccgctccgtcgagcccggcgatctctggtgcgccctgccc
ggtgccaccgcccacggcgcggagttcgccgcccaggccgccggccgcggcgccgccatg
gccctcaccgacccggccggccgggagcgctgcgaggcggcgggactgcccgcgctggtc
gtcgacgatccgcgctccgccaccgcgctcgcggccgcgctggtccacggccggcccgcc
gagcgcctcgccaccatcggggtgaccgggaccaacggcaagacctccgtgaccaccgcg
atcacccgcgcgctgctcgagctcggcgtgcccgccggggcgatcggcaccagcggcacc
agctaccgcgccgccgacggcagcgaccacgcgatcgcgaccgtgcgcaccacccccgag
gcgcccgagctgcacggcctcctggcccgcatggccgaggacggcgtcgaggtggtctcc
atggaggtctccagccacgccctggtgctgcaccgcgccgacgaggtcgtctacgacgtc
gtctgcttcaccaacctcacccaggaccacctcgacttccacggcacgatggaggcctac
tacgaggccaagcgcaccctgttcacccccgcgcacgcccggcgcggcgtcgtctgcgtg
gacgacgactggggccgccgcctggcccgcgaggcgcagatcccggtgacgacctacgcg
acccgccccgggatcgacgccgaccaccgggcccgcgagcaccgtgcggacggctacgga
tcgatcgtcgaggtcgacgggccggacggcacccgcaccctgcacgccgccctgcccggc
cgccactacgtcgccaacaccctggccgcggacctgctgctggccgcgatcggccgcacc
ggcgaggacgtcgtccaggcgctcggcgaggcgggcaccgtccccgggcggatggagccg
gtggcgcacaccccgatccgcggggtcgtcgactactcccacacccccgacgccctcgaa
caggcgctgctgaccctccgggcggtccccggcaccggccggctgctggtggtcatgggc
gccggcggcgaccgcgaccgcgccaagcggcctctcatgggcgaggtcgccgcacgctac
gccgacgtggtgctcgtcacggacgacaacccccgcaccgaggaccccgcggcgatccgc
gccgaggtgctcagcggcatccccgagggcacgaaggcgcaggtccatgacgtggacggg
cgcggcgaggcgatcgccctggccgcgtatctcgcggacgtgtccgacaccatcctcgtg
gcgggcaagggtgccgagaccgggcagcagatcggcggtatcgtccatccgttcgatgac
cgcctccgactgcgggatgcactgcgggatgcgcaaccggcgcgcgggggcgccgacgac
ttggacgaagggcgctga

DBGET integrated database retrieval system