KEGG   Brachybacterium faecium: Bfae_11210Help
Entry
Bfae_11210        CDS       T00965                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bfa  Brachybacterium faecium
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bfa01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bfa00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1264163..1265275
Genome map
AA seq 370 aa AA seqDB search
MTRMSSRAATTLDPHADIAELTAAIVDIESVSGNEEALADAIEQALRTHAPHLEVLRDGD
TVIARTHRGLPRRVLLAGHLDTVPVAANLPSSRRVRDGREELVGRGSCDMKGGVAVFLKL
AVEAVAAPVDLTWLFYDHEEVAAAQNSLTRLAAEHPEHLAADFAVLGEPTSAGVEGGCKG
TMKLEVTARGTAAHSARDWVGDNAIHALAPVLERLSAYRPRRAVIDGLEYCECLNAVAIS
GGIAGNVIPDRASATLNYRFAPDTTVAQAEAHVREVLSGLELEIEVTDAAGGALPGLDHD
AARDFLAALGGAVPVAAKQGWTDVARFAALGTPAVNFGPGDPLLAHTDDEHVPLADLETA
LAGLRRVLSA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcatgagcagccgggcagccaccaccctcgacccccatgccgacatcgccgag
ctcaccgccgcgatcgtcgacatcgaatccgtctccgggaacgaggaggcgctcgccgac
gcgatcgagcaggcgctgcgcacccacgccccgcacctcgaggtgctccgcgacggggac
accgtcatcgcccgcacccaccggggcctgccccggcgggtgctgctggccggccacctg
gacaccgtgcccgtcgccgcgaacctgccctcctcgcgccgggtccgcgacggccgggag
gagctggtgggccgcggcagctgcgacatgaagggcggggtcgcggtgttcctcaagctc
gccgtcgaggcggtcgcggcgccggtggacctcacctggctcttctacgaccatgaggag
gtcgcggcggcgcagaactcgctcacccgcctcgccgccgagcacccggagcacctcgcc
gcggatttcgccgtcctcggcgagcccacctcggccggcgtcgagggcggctgcaagggc
accatgaaactcgaggtgaccgcccgcggcaccgccgcccactccgcccgcgactgggtg
ggggacaatgcgatccacgctctcgcgcccgtgctcgagcggctctccgcctaccggccg
cgccgcgccgtgatcgacgggctcgagtactgcgaatgcctcaacgccgtcgcgatctcc
ggcgggatcgccgggaacgtgatcccggaccgggcgagcgccaccctcaactaccgcttc
gccccggacaccaccgtcgcgcaggccgaggcgcatgtgcgcgaggtcctctccgggctc
gagctggagatcgaggtgaccgacgcggccggcggcgcgctgcccggcctggaccatgac
gccgcccgcgacttcctcgccgctctcggcggggcggtgcccgtcgccgcgaagcagggc
tggacggacgtggcccgcttcgcggcgctcggcaccccggccgtgaacttcggccccggg
gaccctctgctcgcccacaccgatgacgagcacgtgccgctcgccgacctcgagaccgcg
ctcgcggggctgcggcgcgtcctcagcgcctga

DBGET integrated database retrieval system