KEGG   Brachybacterium faecium: Bfae_12630Help
Entry
Bfae_12630        CDS       T00965                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00010  Glycolysis / Gluconeogenesis
bfa00620  Pyruvate metabolism
bfa00640  Propanoate metabolism
bfa00680  Methane metabolism
bfa01100  Metabolic pathways
bfa01110  Biosynthesis of secondary metabolites
bfa01120  Microbial metabolism in diverse environments
bfa01130  Biosynthesis of antibiotics
bfa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bfae_12630
   00620 Pyruvate metabolism
    Bfae_12630
   00640 Propanoate metabolism
    Bfae_12630
  Energy metabolism
   00680 Methane metabolism
    Bfae_12630
Enzymes [BR:bfa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bfae_12630
Lipid biosynthesis proteins [BR:bfa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bfae_12630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 8399810
NCBI-ProteinID: YP_003154696
UniProt: C7MBZ9
Position
1423273..1425249
Genome map
AA seq 658 aa AA seqDB search
MSDDAATGIENLSQETRAFSPPTEFVQNAVARPSLYEEAERDRLAFWRSRASLLSWETPF
TETLDWSNPPFARWFADGTLNAAYNCVDRHVESGHGAQAALLAEYEDGSDATFTYAEVKD
EISRMANVLADCGVKTGDRVAIYMPMIPEAVFAMLACARIGAPHSVVFGGFSAEALRSRI
EDAEARVVITADGQNRRGKQLPLKPAVDEALAGGGASVEKVLVVRRTGGDVDWTEGRDVW
WHEARETASTEHTPVPVEAEHPLFILYTSGTTGKPKGIVHTTGGYLTQAAYTHRNVFDLK
PSTDVFWCTADIGWVTGHTYVVYGPMANRTTQVIYEGTPDTPHQGRWWEVVQKHKVSLFY
SSPTAIRTAMKWGEDIPAQYDLSSLRLLGSVGEAINPEAWMWYRRVIGGDRCPIVDTWWQ
TETGSIMISPLPGITATKPGSAQAALPGISADVVNDAGEPVADGEGGYLVLDEPWPGMLR
GIWGDPERFKETYWSRFEGLYFAGDGAKRDEDGDIWLLGRVDDVMNVSGHRLSTMEIESA
LVSHDWVAEAAVVGANDATTGQSPVAFVILRGGNEDAIAEVGGEEKVPELLRAHVGREIG
PIAKPKKVLLVTELPKTRSGKIMRRLLRDVAENREVGDTQTLADASVMDLIQEGLSGR
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgacgcagccaccgggatcgagaacctctcgcaggagacccgcgccttctct
ccccccaccgagttcgtgcagaacgcggtcgcccgcccctccctctacgaggaggccgag
cgggaccgcctcgcgttctggcgctcacgggccagcctgctcagctgggagaccccgttc
accgagaccctcgactggtccaacccgccgttcgcgcgctggttcgccgacgggacgctg
aacgccgcctacaactgcgtggaccgccacgtggagtccgggcacggcgcgcaggccgcg
ctgctggcggagtacgaggacggctccgacgcgaccttcacctacgccgaggtcaaggac
gagatctcgcgcatggcgaacgtcctggccgactgcggggtcaagaccggcgaccgggtc
gcgatctacatgccgatgatccccgaggccgtcttcgcgatgctcgcctgcgcccgcatc
ggtgcgccccattccgtggtcttcggcggcttcagcgccgaggcgctgcgctcccgcatc
gaggacgccgaggcgcgcgtggtcatcaccgccgacggccagaaccgccgcggcaagcag
ctgcccctgaagcccgccgtcgacgaggcgctcgccggcggcggcgcctcggtcgagaag
gtcctcgtggtgcgccgcaccggcggggacgtcgactggaccgagggccgcgatgtgtgg
tggcacgaggcgcgcgagaccgcctcgaccgagcacacccccgtcccggtggaggccgag
cacccgctgttcatcctctacacctccggcaccaccgggaagccgaagggcatcgtccac
accaccggcggctacctcacgcaggcggcgtacacgcaccgcaacgtgttcgacctcaag
ccctccaccgacgtgttctggtgcacggccgacatcggctgggtcaccggccacacctac
gtggtctacggccccatggccaaccgcaccacccaggtcatctacgagggcaccccggac
accccgcaccagggccgctggtgggaggtcgtccagaagcacaaggtcagcctgttctac
tcctcgcccaccgcgatccgcacggcgatgaagtggggcgaggacatcccggcccagtac
gacctctcctcgctgcgcctgctgggcagcgtcggcgaggcgatcaaccccgaggcgtgg
atgtggtaccgccgcgtcatcggcggggaccgctgccccatcgtggacacgtggtggcag
acggagaccggctcgatcatgatctccccgctgccgggcatcaccgccaccaagccgggc
tcggcgcaggccgccctgcccgggatcagcgccgacgtcgtcaacgacgccggggagccg
gtggccgacggcgagggcggctacctcgtgctcgacgagccgtggcccggcatgctgcgc
ggcatctggggcgacccggagcgcttcaaggagacttactggtcgcgcttcgagggcctg
tacttcgccggtgacggcgccaagcgcgacgaggacggcgacatctggctgctgggccgc
gtggacgatgtcatgaacgtctccgggcaccgcctgtcgacgatggagatcgaatccgcc
ctggtcagccacgactgggtcgccgaggccgccgtggtgggcgcgaacgatgcgaccacc
ggtcagtccccggtggcgttcgtgatcctgcgcggcgggaacgaggacgcgatcgccgag
gtcggcggcgaggagaaggtccccgagctgctgcgcgcccacgtgggccgcgagatcggc
ccgatcgcgaagccgaagaaggtcctgctggtcaccgagctgcccaagacccgctccggc
aagatcatgcgtcgcctgctgcgggacgtcgccgagaaccgcgaggtgggcgacacccag
accctcgccgacgcctcggtgatggatctgatccaggaggggctctccggccgctga

DBGET integrated database retrieval system