KEGG   Brachybacterium faecium: Bfae_12810Help
Entry
Bfae_12810        CDS       T00965                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bfa  Brachybacterium faecium
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bfa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1443786..1444352
Genome map
AA seq 188 aa AA seqDB search
MAVDKPRIEAAVREILAAIGEDPDRDGLLDTPSRVARMYDEVFEGLAQDAREPLSTTFDI
EHQELVLVRDIAFYSMCEHHLLPFHGTAHIGYIPGGGVVTGLSKLARLVNIYARRPQVQE
RLTFQIADALMEELGAGGAIVVIEAEHMCMSMRGVRAAGARTVTSAVRGMLRDSPSTRGE
AMALIHRA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggccgtggacaagccccgcatcgaagccgcggtccgcgagatcctcgccgcgatcggg
gaggaccccgaccgcgacggcctgctggacaccccctcgcgggtggcccgcatgtacgac
gaggtcttcgagggcctcgcccaggacgcccgcgaaccgctgtcgaccaccttcgacatc
gagcaccaggagctggtgctggtgcgcgacatcgccttctactcgatgtgcgagcaccac
ctgctgcccttccacggcaccgcgcacatcgggtacatccccggcggcggggtcgtcacc
gggctgagcaagctcgcccgcctggtgaacatctacgcccgccgcccccaggtgcaggag
cgcctcaccttccagatcgccgatgcgctgatggaggagctcggcgcgggcggggccatc
gtggtgatcgaggcggagcacatgtgcatgtcgatgcgcggggtgcgggccgccggcgcc
cgcaccgtcaccagcgcggtgcgaggcatgctgagggacagccccagcacccgcggcgag
gccatggccctgatccacagggcgtga

DBGET integrated database retrieval system