KEGG   Brachybacterium faecium: Bfae_12810Help
Entry
Bfae_12810        CDS       T00965                                 

Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00790  Folate biosynthesis
bfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bfae_12810
Enzymes [BR:bfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Bfae_12810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-GeneID: 8399828
NCBI-ProteinID: YP_003154714
UniProt: C7MC17
Position
1443786..1444352
Genome map
AA seq 188 aa AA seqDB search
MAVDKPRIEAAVREILAAIGEDPDRDGLLDTPSRVARMYDEVFEGLAQDAREPLSTTFDI
EHQELVLVRDIAFYSMCEHHLLPFHGTAHIGYIPGGGVVTGLSKLARLVNIYARRPQVQE
RLTFQIADALMEELGAGGAIVVIEAEHMCMSMRGVRAAGARTVTSAVRGMLRDSPSTRGE
AMALIHRA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggccgtggacaagccccgcatcgaagccgcggtccgcgagatcctcgccgcgatcggg
gaggaccccgaccgcgacggcctgctggacaccccctcgcgggtggcccgcatgtacgac
gaggtcttcgagggcctcgcccaggacgcccgcgaaccgctgtcgaccaccttcgacatc
gagcaccaggagctggtgctggtgcgcgacatcgccttctactcgatgtgcgagcaccac
ctgctgcccttccacggcaccgcgcacatcgggtacatccccggcggcggggtcgtcacc
gggctgagcaagctcgcccgcctggtgaacatctacgcccgccgcccccaggtgcaggag
cgcctcaccttccagatcgccgatgcgctgatggaggagctcggcgcgggcggggccatc
gtggtgatcgaggcggagcacatgtgcatgtcgatgcgcggggtgcgggccgccggcgcc
cgcaccgtcaccagcgcggtgcgaggcatgctgagggacagccccagcacccgcggcgag
gccatggccctgatccacagggcgtga

DBGET integrated database retrieval system