KEGG   Brachybacterium faecium: Bfae_12820Help
Entry
Bfae_12820        CDS       T00965                                 

Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bfa  Brachybacterium faecium
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bfa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1444358..1445215
Genome map
AA seq 285 aa AA seqDB search
MATASRRPDGLPAHLDVEETLVMGVLNVTPDSFSDGGEHDDAPAAVAHGRRLVAQGAAIV
DVGGESTRPGAPRVDEEEELRRVLPVVSALAADDVVVSVDTMRATVAAASIEAGALIVND
VSAGRADVDMGREAARLRTRLGTPPVFIAMHWRGHSDVMNELAVYEDVARDSAAELAERL
DALREAGVEDRFLAVDPGLGFSKTGEQNWDVLGDWEALASHRLPILVGASRKRFVGALGV
DRDQATAAISAYSAEHGAWAVRVHEVPPSLAAVRVGHRLRRSVRR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgcatcgcgccgccccgacgggctccccgcccacctggacgtcgaggagacc
ctggtgatgggggtcctcaacgtcacccccgattccttctccgacgggggagagcacgac
gacgcccccgccgccgtcgcgcacggacgccgcctggtcgcccagggcgccgcgatcgtc
gacgtcggcggcgagtcgacccgccccggcgcgccgcgggtggacgaggaggaggagctg
cgccgcgtgctgccggtcgtctccgccctcgccgccgacgacgtcgtggtcagcgtcgac
acgatgcgcgccaccgtcgcggcggcgagcatcgaggccggcgcgctgatcgtcaacgat
gtctccgcaggccgtgccgacgtggacatgggccgggaggcggcgcgcctccgcacacgg
ctgggcaccccgccggtgttcatcgcgatgcactggcgcggccacagcgacgtgatgaac
gagctggccgtctacgaggacgtggcgcgcgacagcgccgccgagctcgcggagcggctc
gacgccctgcgcgaggccggggtcgaggaccgcttcctcgcggtcgacccgggcctgggc
ttctccaagaccggcgagcagaactgggacgtgctgggcgactgggaggcgctggcctcc
catcgcctgccgatcctcgtcggcgcctcccgcaagcgcttcgtgggcgcgctcggcgtg
gaccgcgaccaggcgaccgccgcgatcagcgcctacagcgccgagcacggcgcctgggcg
gtgcgcgtgcacgaggtgcccccgtcgctcgccgcggtgcgggtggggcatcgactgcga
cggagcgtgcggcgatga

DBGET integrated database retrieval system