KEGG   Brachybacterium faecium: Bfae_12830Help
Entry
Bfae_12830        CDS       T00965                                 

Definition
dihydroneopterin aldolase/2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
bfa  Brachybacterium faecium
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bfae_12830
Enzymes [BR:bfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Bfae_12830
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     Bfae_12830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1445212..1446129
Genome map
AA seq 305 aa AA seqDB search
MTAFPHPAGPAPARLDRIEVSGIRAWGHHGVLAAETELGQQFLADITLHLSTAPAGTADA
LSRTVNYAEVAHAVEEELRGGPHALVETLAERIAQRILTDTGHPLVRRVGVRVHKPAAPV
GLPVGDVAVSIERDAAPVEAVLALGTNLGDRARHLHDALALLAATDGIDVEWTGPVLETA
PVGGPEGQGAFLNSVIGVRTVLGPFALLEAAHRAERAARRERLVRWGPRTLDVDVITYGD
WSSRDETLTVPHPRAHERAFVLAPWHAARPGDELPGRGPIEELLAGAADRDGLRPGPDIE
GYGLP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccttcccgcacccggcagggcccgccccggcgcggctggaccgcatcgaggtc
agcggcatccgcgcctgggggcaccacggcgtgctcgcggcggagaccgagctcggccag
cagttcctcgccgacatcaccctgcacctgtccaccgctcccgccggcaccgccgacgcc
ctctcccggacggtcaactacgcggaggtcgcccacgcggtcgaggaggagctccgcggc
ggcccgcacgccctcgtcgagaccctcgccgaacggatcgcgcagcgcatcctcaccgac
accggccatcctctggtgcgccgcgtcggcgtgcgcgtccacaagccggccgcgcccgtc
ggcctgcccgtcggcgacgtcgccgtgagcatcgagcgcgacgccgccccggtcgaggcg
gtcctcgccctgggcaccaacctcggcgaccgcgcccggcacctgcacgacgccctcgcc
ctgctggcggcgacggacggcatcgacgtggagtggaccggcccggtgctcgagaccgcc
cccgtcggcggccccgagggccagggcgcgttcctgaactcggtgatcggggtgcgcacg
gtgctgggacccttcgccctgctggaggccgcccaccgcgccgagcgcgccgcccgccgg
gagcgtctggtgcgctgggggccgcgcaccctcgacgtcgacgtcatcacctacggcgac
tggagcagccgggacgagaccctcacggtgccgcacccgcgcgcccacgagcgagccttc
gtgctcgcgccctggcacgccgcacgccccggcgacgagctgccgggccgcggcccgatc
gaggagctgctggccggcgccgcggaccgcgacgggctgcggccgggacccgacatcgag
gggtacgggctcccgtga

DBGET integrated database retrieval system