KEGG   Brachybacterium faecium: Bfae_13180Help
Entry
Bfae_13180        CDS       T00965                                 

Definition
cellobiohydrolase A (1,4-beta-cellobiosidase A) (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bfa  Brachybacterium faecium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bfae_13180
Enzymes [BR:bfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Bfae_13180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1481183..1482262
Genome map
AA seq 359 aa AA seqDB search
MTTTRRSLLSAAAAAAVVALSATGCNAADEAAPPAMSASAAAEPGSTAEPDASAETGSAA
AQEGAAAPAVGQELYAAPESPVLSWVEENASDERAETIRAEIGQQPMAQWFGSWSGPITE
ATEELTSAAQEEGALPIMVAYNISGRDACGGHSGGGAGSPEAYEAWIRDYARGIGDSPAL
VILEPDALGDYECMTDAQIEEREGMLRTAIAQFAEEAPNAWVYLDAGNSAWVEAETMAER
LEAAGLEDAHGFSLNVSNYLSTESNVAYAEAVNEQLSAEAGFTAPFVIDTSRNGKGEEGV
DWCNPAGQQLGETSRWGEDAELLLWIKTPGESDGDCGVGEGSEAGEFLPEVAMGLISGE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacccgacgctcgctcctgtccgccgctgcggccgccgccgtggtggcgctg
tcggcgaccggctgcaacgctgccgacgaggcggcaccgccggcgatgtccgcgtcggcc
gctgcggaacccggatccaccgcagagcccgacgccagtgcggagaccgggtccgccgcg
gcgcaggagggcgcagcagcgcccgccgtggggcaggagctctacgcggcgccggagtct
ccggtgctcagctgggtcgaggagaacgcctcggacgagcgcgccgagacgatccgcgcc
gagatcggccagcagccgatggcccagtggttcggcagctggagcgggcccatcaccgag
gccacggaggagctcacctcggcagcgcaggaggagggtgcgctgccgatcatggtcgcg
tacaacatctccggccgcgacgcctgcggtgggcactccggtggaggggcgggatcccct
gaagcctatgaggcctggatccgcgactatgcgcgcggcatcggcgacagccccgccctg
gtgatcctggagccggatgcgctgggcgactacgagtgcatgaccgatgcacagatcgag
gagcgagagggcatgctgcgcactgcgatcgcacagttcgccgaggaggccccgaacgcg
tgggtctatctcgatgccggcaactccgcctgggtggaggcggagaccatggctgagcgc
ctcgaggcggcggggctcgaggacgcgcacggcttctcgctcaacgtctcgaactatctg
agcaccgagtccaacgtcgcctatgccgaggccgtgaacgagcagctgagcgccgaggcc
gggttcacggcgccgttcgtgatcgacacgagccgcaacggcaagggcgaggagggcgtc
gactggtgcaaccccgccggccagcagctcggcgagaccagccggtggggcgaggacgcg
gagctcctgctgtggatcaagactcccggcgagtccgatggggactgcggcgtgggggag
gggtccgaggcgggcgagttcctccccgaggtggcgatggggctgatctccggcgagtga

DBGET integrated database retrieval system