KEGG   Brachybacterium faecium: Bfae_13220Help
Entry
Bfae_13220        CDS       T00965                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bfa  Brachybacterium faecium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bfae_13220
Enzymes [BR:bfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Bfae_13220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1484391..1486544)
Genome map
AA seq 717 aa AA seqDB search
MAPDSSALRDLARDLGVSTRYWGWDGVLQDVSDDTLHAVLAALGAPVDSAEDIAAVRRER
ARAPWARTLPPVTVLREDAATTVPVHVDHGTSVRAHLRLEDGGRRDLEQAEDHTPPFDLD
GTLRGRARFHLPSHLPLGWHRLVADTEQGPVEADLVVTPARLTAHEEFVAQRAFGLQAQL
YSVRSQRSWGIGDLADLRDLAAISGARHGADFLLLNPLHASYPTPPVEPSPYLPVTRRFT
SALYLRIEDVPEHRELTDFARQRIALLRERVAGWNDRVEHLERDEVLAAKLEALEELVAV
PLTAGRQALLDAFRAREGQGLEDFALWCAIAERVRGTADEACLRALDETTLAQARRELSA
RIDFHVRVQWWLDEQLGAAQAAARDAGMRIGIMHDLAVGVEQVGADAWRLRDVLASGAAV
GAPADQYNQQGQNWHQPPWHPERLREASYRPWRDMLRTLMRHAGALRIDHVLGLFRLWWI
PEGHGAADGAYVSYDHEAMLGILALEAQRSGTLVVGEDLGTFEPWVRDTLVDRGILGTSI
LWFEYDAQGRPLRAEDYRTLCMASVNTHDLPPTAGYLAGDHVSLRHELGLLERGLDEELA
ADAAGRQQVLDLLRAEGLLAEGGAADDGDADAAGIEETVLALHRHLARTPSVLLGVSLVD
CVGERRIQNQPGTDEEYPNWRIPLADAAQSPVSIDDIATDARTARLLAAVREGIGRG
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggccccagattcctcagcgctgcgagatctcgcccgcgacctcggtgtcagcacccgg
tactggggctgggacggcgtcctccaggatgtctccgacgacaccctccatgccgtcctc
gcggcgctcggcgcaccggtggactccgcggaggacatcgcagccgtgcggcgcgagcgc
gcacgcgccccctgggcccgcaccctgccgccggtgacggtgctgcgcgaggacgccgcc
acgacggtgcccgtccacgtcgaccacggcacctcggtgcgcgcgcacctgcggctggag
gacggcgggcggcgcgacctcgagcaggccgaggaccacaccccgccgttcgacctcgac
ggcaccctgcgcggccgggcccgcttccatctcccctcgcatctgccgctgggctggcac
cggctcgtggcggacacggagcaggggccggtcgaggcggatctcgtggtcaccccggcg
cgcctgaccgcccacgaggagttcgtcgcccagcgcgccttcggcctgcaggcccagctc
tactcggtccgctcgcagcgctcctggggcatcggcgacctcgccgacctccgcgacctc
gccgcgatctccggtgcccgccacggcgcggacttcctgctgctgaacccgctgcacgcc
tcgtacccgaccccgccggtggagccctccccctatctcccggtcacgcgccgcttcacg
agcgcgctgtacctgcgcatcgaggacgtgcccgagcatcgcgagctcaccgacttcgcg
cgccagcggatcgccctgctgcgggagcgggtggcggggtggaacgaccgcgtggagcat
ctcgagcgcgatgaggtgctcgcggcgaagctcgaggcgctcgaggagctggtcgcggtg
ccgctgaccgcgggccggcaggccctgctggacgccttccgcgcccgggagggccagggc
ctggaggacttcgcgctgtggtgcgcgatcgcggagcgggtgcgcggcacggccgacgag
gcgtgcctgcgggctctcgacgagaccactctcgcccaggcgcggcgcgagctctccgca
cgcatcgacttccacgtccgggtgcagtggtggctcgacgagcagctgggcgccgcgcag
gccgcggcccgcgacgccgggatgcggatcggcatcatgcacgacctcgccgtgggggtc
gagcaggtcggtgccgacgcgtggcggctgcgcgacgtgctcgccagcggcgcggccgtc
ggcgcaccggccgatcagtacaaccagcaggggcagaactggcatcagccgccctggcat
cccgagcgcctgcgggaggcctcctaccggccgtggcgggacatgctgcgcaccctgatg
cggcatgccggggcgctgcggatcgaccatgtgctggggctgttccggctgtggtggatc
ccggagggccacggggcggccgacggcgcctacgtctcctacgaccacgaggcgatgctc
ggcatcctcgccctggaggcgcagcgctcgggcacgctcgtggtcggcgaggacctcggg
accttcgagccgtgggtgcgcgacaccctcgtggaccgcgggatcctgggcacctcgatc
ctgtggttcgagtacgacgcgcagggacgaccgctgcgtgcggaggactaccgcaccctg
tgcatggcctcggtgaacacccacgacctgccgcccacggccgggtatctcgccggcgat
cacgtcagcctgcggcacgagctgggcctgctcgagcgcggcctggacgaggagctcgcc
gcggacgccgccgggcggcagcaggtgctcgacctgctgcgggccgaggggctgctcgcc
gagggcggcgctgcggacgacggcgatgccgatgccgccggcatcgaggagacggtgctc
gcgctgcaccgccacctggcccgcactccctcggtgctgctgggtgtctccctcgtggac
tgcgtgggcgagcgacggatccagaaccagccgggcaccgacgaggagtacccgaactgg
cggatcccgctcgcggacgccgcgcagtcccctgtctcgatcgacgacatcgcgaccgat
gcgcgcaccgcgcgcctgctggcggcggtgcgcgaggggatcggccggggctga

DBGET integrated database retrieval system