KEGG   Brachybacterium faecium: Bfae_13310Help
Entry
Bfae_13310        CDS       T00965                                 

Definition
(RefSeq) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00900  Terpenoid backbone biosynthesis
bfa01100  Metabolic pathways
bfa01110  Biosynthesis of secondary metabolites
bfa01130  Biosynthesis of antibiotics
Module
bfa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bfae_13310
Enzymes [BR:bfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Bfae_13310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 8399878
NCBI-ProteinID: YP_003154763
UniProt: C7MC66
Position
1494850..1495776
Genome map
AA seq 308 aa AA seqDB search
MAQALQRVVVRAPGKINLSLGVGPVDDRGYHALATVFQAVDLYETITATRAEALTLEMTS
EVAGEVPLDASNLALRAAELLREECALGEGAALHIHKQVPIAGGMGGGSADAAAVLVALD
RLWGLDLGAERLRHLGARLGADVPFAMLGHTALGRGNGGDLTTVLTHGEWTWLLAVPGGH
LSTPAVFRRFDEIVAQTGRVPSSHPGVDERQLQALSSGNIALLADTLHNDLQAAAFALHP
GLEPVVEEAERLGAPAALVSGSGPTVAVLVEDEAQARSLAAGLRHASLVETCLVARGSAP
GASVLEEE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggcgctgcagcgggtggtggtgcgcgcccccgggaagatcaacctctcgctc
ggggtggggccggtcgatgaccgcggctatcacgccctggcgacggtgttccaggccgtg
gatctctacgagacgatcaccgccacccgggcggaggcgctgaccctggagatgacctcc
gaggtggcgggggaggttccgctggatgccagcaacctcgccctgcgggcggcggagctc
ctgcgcgaggagtgcgcgctcggcgagggtgctgccctgcacatccacaaacaggtcccg
atcgccggcgggatgggcggagggtcggccgatgccgccgccgtcctggtggcgctggac
cgcctgtgggggctcgacctgggtgcggagcggctgcggcacctcggcgcgcgcctcggg
gccgacgtccccttcgccatgctcggccacacggcgctgggccgcggcaacggcggggac
ctcaccacggtgctcacccacggggagtggacctggctgctggccgtccccggcgggcat
ctctccacccccgcggtgttccgacgcttcgacgagatcgtcgcgcagacggggcgggtg
ccctcctcccaccccggcgtggacgagcggcagctccaggccctcagcagcggcaacatc
gccctgctcgccgacactctgcacaacgatctccaggcggccgcgttcgccctgcacccc
gggctggagccggtggtcgaggaggccgagcggctcggggcgccggcggccctggtgagc
ggctccgggccgacggtcgcggtgctcgtcgaggacgaggcgcaggcacgatccctcgcc
gccgggctgaggcacgcctcgctggtcgagacctgcctcgtggcacgcggctccgcgccg
ggagcgagcgtgctcgaggaggaatga

DBGET integrated database retrieval system