KEGG   Brachybacterium faecium: Bfae_13310Help
Entry
Bfae_13310        CDS       T00965                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bfa  Brachybacterium faecium
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bfa00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1494850..1495776
Genome map
AA seq 308 aa AA seqDB search
MAQALQRVVVRAPGKINLSLGVGPVDDRGYHALATVFQAVDLYETITATRAEALTLEMTS
EVAGEVPLDASNLALRAAELLREECALGEGAALHIHKQVPIAGGMGGGSADAAAVLVALD
RLWGLDLGAERLRHLGARLGADVPFAMLGHTALGRGNGGDLTTVLTHGEWTWLLAVPGGH
LSTPAVFRRFDEIVAQTGRVPSSHPGVDERQLQALSSGNIALLADTLHNDLQAAAFALHP
GLEPVVEEAERLGAPAALVSGSGPTVAVLVEDEAQARSLAAGLRHASLVETCLVARGSAP
GASVLEEE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggcgctgcagcgggtggtggtgcgcgcccccgggaagatcaacctctcgctc
ggggtggggccggtcgatgaccgcggctatcacgccctggcgacggtgttccaggccgtg
gatctctacgagacgatcaccgccacccgggcggaggcgctgaccctggagatgacctcc
gaggtggcgggggaggttccgctggatgccagcaacctcgccctgcgggcggcggagctc
ctgcgcgaggagtgcgcgctcggcgagggtgctgccctgcacatccacaaacaggtcccg
atcgccggcgggatgggcggagggtcggccgatgccgccgccgtcctggtggcgctggac
cgcctgtgggggctcgacctgggtgcggagcggctgcggcacctcggcgcgcgcctcggg
gccgacgtccccttcgccatgctcggccacacggcgctgggccgcggcaacggcggggac
ctcaccacggtgctcacccacggggagtggacctggctgctggccgtccccggcgggcat
ctctccacccccgcggtgttccgacgcttcgacgagatcgtcgcgcagacggggcgggtg
ccctcctcccaccccggcgtggacgagcggcagctccaggccctcagcagcggcaacatc
gccctgctcgccgacactctgcacaacgatctccaggcggccgcgttcgccctgcacccc
gggctggagccggtggtcgaggaggccgagcggctcggggcgccggcggccctggtgagc
ggctccgggccgacggtcgcggtgctcgtcgaggacgaggcgcaggcacgatccctcgcc
gccgggctgaggcacgcctcgctggtcgagacctgcctcgtggcacgcggctccgcgccg
ggagcgagcgtgctcgaggaggaatga

DBGET integrated database retrieval system