KEGG   Brachybacterium faecium: Bfae_13390Help
Entry
Bfae_13390        CDS       T00965                                 

Definition
(RefSeq) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00030  Pentose phosphate pathway
bfa00230  Purine metabolism
bfa01100  Metabolic pathways
bfa01110  Biosynthesis of secondary metabolites
bfa01120  Microbial metabolism in diverse environments
bfa01130  Biosynthesis of antibiotics
bfa01200  Carbon metabolism
bfa01230  Biosynthesis of amino acids
Module
bfa_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bfae_13390
  Nucleotide metabolism
   00230 Purine metabolism
    Bfae_13390
Enzymes [BR:bfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     Bfae_13390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-GeneID: 8399886
NCBI-ProteinID: YP_003154770
UniProt: C7MC73
Position
1503642..1504622
Genome map
AA seq 326 aa AA seqDB search
MSGIVTTGEKRLVLASGRAHPVLAQEVAAELGVDVLPMDAWDFANGEIYVRYGESVRGTD
VFVLQSHPAPINTWVMEHLIMIDALKRASAKRITAIAPSFPYARQDKKHRGREPISARLV
ADLYETAGADRMISVDLHAPQVQGYFERPVDHLMALPILAEYIQAKYGHEDIAVVSPDAG
RIRVAEQWAKKLGGVNLAFIHKSRDPKRPNQAVAKRVIGDVTGKTCILVDDMIDTAGTIV
QAADALVANGAESVVIATTHPILSDPATERLKASSVREVVCTNTLPVPPEKQFDRLTQLS
IAPLLARAIRAVFDDGSVTSIFDGEV
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaatcgtcaccaccggggagaagcgactggtcctcgcttcgggacgggcgcat
cccgtcctcgcgcaggaggtcgccgccgagctcggcgtggacgtcctgccgatggatgcc
tgggacttcgccaacggagagatctatgtgcgctacggggagtccgtgcgcggcaccgac
gtcttcgtgctccagtcgcatcccgccccgatcaacacctgggtgatggagcacctcatc
atgatcgatgcgctcaagcgcgcatcggccaagcggatcaccgcgatcgccccgagcttc
ccctacgcgcggcaggacaagaagcaccgcggccgcgagccgatctccgcccgcctggtc
gcggacctgtacgagaccgccggcgcggaccgcatgatctccgtggacctccacgccccg
caggtgcagggctatttcgagcgcccggtggatcacctcatggccctgccgatcctcgcc
gagtacatccaggccaagtacggccacgaggacatcgccgtggtctccccggatgcgggc
cggatccgcgtcgcggagcagtgggccaagaagctcggcggcgtcaacctcgccttcatc
cacaagtcccgcgaccccaagcgccccaaccaggccgtggccaagcgcgtgatcggtgac
gtgaccggcaagacctgcatcctcgtcgacgacatgatcgacaccgccggcaccatcgtg
caggccgcggatgcgctcgtcgccaacggggcggagtcggtggtcatcgcgaccacccat
ccgatcctctcggacccggcgaccgagcgcctcaaggccagctcggtgcgcgaggtggtg
tgcaccaacaccctcccggtgccgcccgagaagcagttcgaccggctcacccagctgtcg
atcgccccgctgctggcccgcgcgatccgtgcggtcttcgatgacggctcggtgaccagc
atcttcgacggcgaggtctga

DBGET integrated database retrieval system