KEGG   Brachybacterium faecium: Bfae_13390Help
Entry
Bfae_13390        CDS       T00965                                 

Definition
ribose-phosphate pyrophosphokinase (EC:2.7.6.1)
Orthology
K00948  
ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
bfa  Brachybacterium faecium
Pathway
Pentose phosphate pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
PRPP biosynthesis, ribose 5P => PRPP
Class
Metabolism; Overview; Carbon metabolism [PATH:bfa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bfa01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bfa00030]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bfa00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1503642..1504622
Genome map
AA seq 326 aa AA seqDB search
MSGIVTTGEKRLVLASGRAHPVLAQEVAAELGVDVLPMDAWDFANGEIYVRYGESVRGTD
VFVLQSHPAPINTWVMEHLIMIDALKRASAKRITAIAPSFPYARQDKKHRGREPISARLV
ADLYETAGADRMISVDLHAPQVQGYFERPVDHLMALPILAEYIQAKYGHEDIAVVSPDAG
RIRVAEQWAKKLGGVNLAFIHKSRDPKRPNQAVAKRVIGDVTGKTCILVDDMIDTAGTIV
QAADALVANGAESVVIATTHPILSDPATERLKASSVREVVCTNTLPVPPEKQFDRLTQLS
IAPLLARAIRAVFDDGSVTSIFDGEV
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaatcgtcaccaccggggagaagcgactggtcctcgcttcgggacgggcgcat
cccgtcctcgcgcaggaggtcgccgccgagctcggcgtggacgtcctgccgatggatgcc
tgggacttcgccaacggagagatctatgtgcgctacggggagtccgtgcgcggcaccgac
gtcttcgtgctccagtcgcatcccgccccgatcaacacctgggtgatggagcacctcatc
atgatcgatgcgctcaagcgcgcatcggccaagcggatcaccgcgatcgccccgagcttc
ccctacgcgcggcaggacaagaagcaccgcggccgcgagccgatctccgcccgcctggtc
gcggacctgtacgagaccgccggcgcggaccgcatgatctccgtggacctccacgccccg
caggtgcagggctatttcgagcgcccggtggatcacctcatggccctgccgatcctcgcc
gagtacatccaggccaagtacggccacgaggacatcgccgtggtctccccggatgcgggc
cggatccgcgtcgcggagcagtgggccaagaagctcggcggcgtcaacctcgccttcatc
cacaagtcccgcgaccccaagcgccccaaccaggccgtggccaagcgcgtgatcggtgac
gtgaccggcaagacctgcatcctcgtcgacgacatgatcgacaccgccggcaccatcgtg
caggccgcggatgcgctcgtcgccaacggggcggagtcggtggtcatcgcgaccacccat
ccgatcctctcggacccggcgaccgagcgcctcaaggccagctcggtgcgcgaggtggtg
tgcaccaacaccctcccggtgccgcccgagaagcagttcgaccggctcacccagctgtcg
atcgccccgctgctggcccgcgcgatccgtgcggtcttcgatgacggctcggtgaccagc
atcttcgacggcgaggtctga

DBGET integrated database retrieval system