KEGG   Brachybacterium faecium: Bfae_13950Help
Entry
Bfae_13950        CDS       T00965                                 

Definition
Holliday junction DNA helicase, RuvA subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bfa  Brachybacterium faecium
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bfae_13950
Enzymes [BR:bfa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Bfae_13950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1570034..1570651
Genome map
AA seq 205 aa AA seqDB search
MIASLTGRVARIDLDSLVLEVGGIGYLVRTTPQALSATRHGAELTLHTELVVREDSMTLF
GFPQLEEAETFRIVQSVSGIGPRTALAVLAVLEPEELRRAVAEQDAKTITRTPGIGPKVA
GRMLLELGGKLPAPASLSAVPGTPAAEAPATPSGADADVVEALVGLGWAEKAALKAVESA
RADDGAELDSAELLRRALRGLGGNR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcatccctgaccgggcgtgtcgcccgcatcgacctcgactccctcgtgctcgag
gtgggcggcatcggctacctcgtccgcaccaccccgcaggcgctgagcgccacccgccac
ggggccgagctgaccctgcacaccgagctggtggtgcgcgaggactcgatgaccctcttc
ggcttcccccagctcgaggaggccgagaccttccgcatcgtgcagtccgtctccggcatc
gggccgcgcacggcgctcgcggtgctcgcggtgctcgagcccgaggagctgcgccgcgcg
gtcgccgagcaggacgcgaagaccatcacccgcacccccggcatcgggccgaaggtcgcc
ggccgcatgctgctcgagctgggcggcaagctgcccgccccggcgtccctctcggccgtc
cccggcacgcccgcggcggaggcgccggccacgccgagcggcgccgacgccgatgtggtc
gaggccctcgtcggtctcggctgggcggagaaggcggcgctcaaggcggtcgagtcggcc
cgcgccgatgacggtgcggagctggattccgccgagctgctgcgccgggcgctgcgcggg
ctgggagggaaccgatga

DBGET integrated database retrieval system