KEGG   Brachybacterium faecium: Bfae_14730Help
Entry
Bfae_14730        CDS       T00965                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bfa  Brachybacterium faecium
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bfae_14730
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bfae_14730
Enzymes [BR:bfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Bfae_14730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1660631..1661593
Genome map
AA seq 320 aa AA seqDB search
MRHFISIGDLSREEAVSVLATAEHMAETQSRSLRKLPTLVGATVVNLFFEDSTRTRISFE
AAAKRLSADVINFSAKGSSLSKGESLKDTALTLQAMGADAVVVRSGSSGAAHLLAHAGWI
DQPIVNAGDGAHEHPTQAMLDAFTLRRHLRPGDARAGLDGLHVVIVGDVLHSRVARSNVL
LLTLLGARVTLVAPPALVPVGASAWPCEITYDLDEALAAAPDAVMMLRVQRERMVGGGFF
PTAGEYSRRYGLTVARADTLPEHAIVMHPGPMNRGFEIAGAVADSPRSVIVEQVASGVFV
RMAVLYHLLATDVREGPREN
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacttcatctcgatcggcgacctcagtcgcgaggaggcggtgtccgtgctcgcg
accgcggagcacatggccgagacccagtcgcgctcgctgcgcaagctgcccaccctggtg
ggcgccaccgtggtgaacctcttcttcgaggactccacccgcacccggatcagcttcgag
gccgccgccaagcgcctctcggccgacgtcatcaacttctccgcgaagggctcgagcctg
tccaagggcgagtccctcaaggacaccgcgctgaccctgcaggccatgggcgcggacgcg
gtcgtggtgcgctcgggctcctccggcgcggcgcatctgttggcccacgccgggtggatc
gaccagccgatcgtcaacgccggggacggcgcgcacgagcatcccacccaggcgatgctc
gacgccttcaccctgcgccgccacctgcgcccgggcgacgcccgcgccggcctcgacggg
ctgcacgtggtgatcgtcggcgacgtgctgcactcgcgggtggcgcgctccaacgtgctg
ctgctgaccctcctcggcgcccgcgtcaccctggtggccccgcccgcgctggtgcccgtc
ggcgcctccgcctggccgtgcgagatcacctacgacctcgacgaggccctcgccgccgcg
ccggacgccgtgatgatgctgcgcgtgcagcgcgaacggatggtgggcggcggcttcttc
cccaccgcgggggagtactcgcgccgctacggcctgaccgtcgcgcgcgccgacaccctg
cccgagcacgcgatcgtcatgcatcccggcccgatgaaccgcggcttcgagatcgccggg
gccgtcgccgactccccgcgcagcgtcatcgtcgaacaggtcgcctccggcgtgttcgtc
cggatggccgtcctctaccacctgctcgccaccgacgtccgggagggcccccgtgagaac
tga

DBGET integrated database retrieval system