KEGG   Brachybacterium faecium: Bfae_14800Help
Entry
Bfae_14800        CDS       T00965                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bfa  Brachybacterium faecium
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bfa00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1669332..1669931
Genome map
AA seq 199 aa AA seqDB search
MNESTTGAGAVTAPAPVTVLAGPTAVGKGTVSAAIRARYPEIWLSVSATTRAPRPGEIDG
VHYRFVSEEEFSALIDSGQMLEWAVVHGRNKYGTPRGPVDEKVAEGRPVLLEIDLAGARQ
VRESLPEARFVFLAPPDWETLVDRLVGRGTEGAEERERRLATARVELAAEGEFDVTIVND
TVDRAADELARLLGVRDLT
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgagtccaccaccggggccggcgccgtcacggcgccggccccggtcaccgtcctg
gccggtcccaccgccgtgggcaagggcaccgtctccgcggcgatccgtgcccgctatccc
gagatctggctgtccgtctccgcgaccacccgggcgccgcgccccggtgagatcgacggc
gtgcactaccgcttcgtcagcgaggaggagttcagcgcgctgatcgactccgggcagatg
ctcgagtgggccgtggtgcacggccgcaacaagtacggcaccccgcgcgggcccgtcgac
gagaaggtcgccgagggccgccccgtgctgctcgagatcgacctggccggcgcccggcag
gtgcgggagtccctgcccgaggcgcgcttcgtgttcctcgccccgccggactgggagacc
ctcgtcgaccgcctggtgggccggggcaccgagggtgccgaggagcgcgagcgccgcctg
gccaccgcccgggtggagctcgccgccgagggggagttcgacgtcacgatcgtcaacgac
accgtggatcgcgcggccgacgagctcgcccgcctcctcggggtgcgcgacctcacctga

DBGET integrated database retrieval system