KEGG   Brachybacterium faecium: Bfae_14890Help
Entry
Bfae_14890        CDS       T00965                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bfa  Brachybacterium faecium
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bfae_14890
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bfae_14890
Enzymes [BR:bfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Bfae_14890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1676617..1677450
Genome map
AA seq 277 aa AA seqDB search
MTTTGTVLDDIIVGVREDLATRRDAVPEAEIDRRARAAAPALDAAARLRGDGSTMGLIAE
VKRSSPSKGALAEIPEPAELAATYAASGASAISVLTEQRRFRGSLADLDAVRARVDVPVL
RKDFVVEPYQVLEARAHGADLVLLIVAALDDVQLRELHDLATELGMQALVETHTHGELER
ALALEADIIGVNARNLKDLTVDLGRAADLLARIPAGPLAIGESAVASAADVEAYAAAGAD
AVLVGEALVTSGDPAGEAASYRRVARRGRPQPEGAHA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccaccggaaccgttctcgacgacatcatcgtcggtgtgcgggaggacctcgcc
acgcgacgggacgccgtccccgaggcggagatcgatcgccgcgcccgcgccgcggccccc
gccctcgacgccgccgcccgcctgcgcggcgacggcagcaccatggggctgatcgccgag
gtcaagcgctccagcccctccaagggcgccctcgccgagatccccgagccggccgagctc
gccgccacctacgcggcctccggcgcctccgcgatcagcgtcctcaccgagcagcgccgc
ttccgcggctccctcgcggacctcgacgccgtccgcgcccgcgtggacgtgcccgtgctg
cgcaaggacttcgtcgtcgagccctaccaggtgctcgaggcccgcgcccacggcgccgat
ctcgtgctgctcatcgtcgccgccctcgacgacgtccagctgcgcgagctgcacgacctc
gcgaccgagctcggcatgcaggccctcgtcgagacccacacgcacggcgagctcgagcgc
gccctcgccctcgaggcggacatcatcggcgtcaacgcccgcaacctcaaggacctcacc
gtcgacctcggccgcgccgccgatctgctggcccggatccccgccggccccctcgcgatc
ggcgaatccgccgtggcctccgccgcggacgtcgaggcctatgccgccgcgggagccgat
gcggtgctcgtcggcgaggccctggtcacctcgggcgaccccgccggcgaagccgcctcg
taccgtcgggtggcccgccgtggccgcccccagccggaaggagctcacgcatga

DBGET integrated database retrieval system