KEGG   Brachybacterium faecium: Bfae_14890Help
Entry
Bfae_14890        CDS       T00965                                 

Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bfa01100  Metabolic pathways
bfa01110  Biosynthesis of secondary metabolites
bfa01130  Biosynthesis of antibiotics
bfa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bfae_14890
Enzymes [BR:bfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Bfae_14890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-GeneID: 8400036
NCBI-ProteinID: YP_003154910
UniProt: C7MCL3
Position
1676617..1677450
Genome map
AA seq 277 aa AA seqDB search
MTTTGTVLDDIIVGVREDLATRRDAVPEAEIDRRARAAAPALDAAARLRGDGSTMGLIAE
VKRSSPSKGALAEIPEPAELAATYAASGASAISVLTEQRRFRGSLADLDAVRARVDVPVL
RKDFVVEPYQVLEARAHGADLVLLIVAALDDVQLRELHDLATELGMQALVETHTHGELER
ALALEADIIGVNARNLKDLTVDLGRAADLLARIPAGPLAIGESAVASAADVEAYAAAGAD
AVLVGEALVTSGDPAGEAASYRRVARRGRPQPEGAHA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccaccggaaccgttctcgacgacatcatcgtcggtgtgcgggaggacctcgcc
acgcgacgggacgccgtccccgaggcggagatcgatcgccgcgcccgcgccgcggccccc
gccctcgacgccgccgcccgcctgcgcggcgacggcagcaccatggggctgatcgccgag
gtcaagcgctccagcccctccaagggcgccctcgccgagatccccgagccggccgagctc
gccgccacctacgcggcctccggcgcctccgcgatcagcgtcctcaccgagcagcgccgc
ttccgcggctccctcgcggacctcgacgccgtccgcgcccgcgtggacgtgcccgtgctg
cgcaaggacttcgtcgtcgagccctaccaggtgctcgaggcccgcgcccacggcgccgat
ctcgtgctgctcatcgtcgccgccctcgacgacgtccagctgcgcgagctgcacgacctc
gcgaccgagctcggcatgcaggccctcgtcgagacccacacgcacggcgagctcgagcgc
gccctcgccctcgaggcggacatcatcggcgtcaacgcccgcaacctcaaggacctcacc
gtcgacctcggccgcgccgccgatctgctggcccggatccccgccggccccctcgcgatc
ggcgaatccgccgtggcctccgccgcggacgtcgaggcctatgccgccgcgggagccgat
gcggtgctcgtcggcgaggccctggtcacctcgggcgaccccgccggcgaagccgcctcg
taccgtcgggtggcccgccgtggccgcccccagccggaaggagctcacgcatga

DBGET integrated database retrieval system