KEGG   Brachybacterium faecium: Bfae_14900Help
Entry
Bfae_14900        CDS       T00965                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bfa  Brachybacterium faecium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bfae_14900
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bfae_14900
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bfae_14900
Enzymes [BR:bfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bfae_14900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
1677447..1678793
Genome map
AA seq 448 aa AA seqDB search
MSSPDPDRARTAGVVPDLTRPTTALRSEMGPYFGDFGGRFLPEALVPALDELTEMYEKAL
IDPEFTAELQQLAAQYTGRPSLLSEAPRFSQLAGGARILLKREDLNHTGSHKINNVLGQA
LLTRRMGKTRVIAETGAGQHGVATATAAALFGLDCTIYMGAEDTERQALNVARMRLLGAE
VVAVDQGSRTLKDAINEAFRDWVANVETTHYLLGTVAGPHPFPAMVRDFHRIIGEEARAQ
TLERVGRLPDAVVACVGGGSNAMGIFHAFLDDTDPAVRLIGCEAGGDGLSSGRHSATITG
GTAGVLHGARSFVMQDEDGQTIESHSVSAGLDYPSVGPEHAWLADIGRAEYRAIDDGPAM
EAFALLSMTEGIMPAIESAHALAGALALGRELGEDAVILVSLSGRGDKDVDTASRWFGLV
GDEPARADLAALRDAARRISPDQAQEPR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccccgaccccgaccgcgcccggaccgccggcgtcgtcccggacctcacccgg
cccaccaccgcgctgcgctccgagatggggccctacttcggcgacttcggcggccgcttc
ctgcccgaggccctcgtgcccgcgctcgacgagctcaccgagatgtacgagaaggcgctc
atcgaccccgagttcaccgccgagctgcagcagctggccgcccagtacaccggccggccc
tcgctgctgtccgaggcgccgcgcttctcccagctggcgggcggtgcgcgcatcctgctc
aagcgcgaggacctcaaccacaccggctcccacaagatcaacaacgtgctgggccaggcc
ctgctcacccgccggatgggcaagacccgcgtgatcgccgagaccggcgcgggccagcac
ggcgtggcgaccgcgaccgccgcagcgctgttcggcctggactgcaccatctacatgggc
gccgaggacaccgagcggcaggcgctgaacgtggcccgcatgcggctgctcggcgccgag
gtggtcgccgtcgaccagggctcgcgcaccctcaaggacgcgatcaacgaggccttccgc
gactgggtcgccaacgtggagaccacccactacctgctgggcaccgtcgccggcccccat
cccttccccgccatggtgcgcgacttccaccgcatcatcggcgaggaagcccgcgcacag
accctcgagcgggtgggacgcctgcccgacgccgtcgtggcctgcgtgggcggcggctcc
aacgcgatgggcatcttccacgccttcctcgatgacacggacccggcggtgcgtctcatc
ggctgcgaggccggcggtgacggcctctcctcgggccgccactcggcgaccatcaccggc
ggcaccgccggggtgctccacggcgcccgcagcttcgtcatgcaggacgaggacggccag
accatcgagtcgcactccgtctccgcgggcctggactatcccagcgtcggccccgagcac
gcctggctggcggacatcggccgggccgagtaccgcgcgatcgacgacggccccgcgatg
gaggccttcgcgctgctgtccatgaccgagggcatcatgcccgcgatcgagtccgcccac
gccctcgccggagcgctcgccctgggccgcgagctgggcgaggacgcggtgatcctggtg
agcctctccggtcgcggcgacaaggacgtggacaccgcctcgcgctggttcgggctggtg
ggggacgagccggcccgcgccgatctcgccgccctgcgcgatgccgcccgccgcatcagc
cccgaccaggcacaggagccccgatga

DBGET integrated database retrieval system