KEGG   Brachybacterium faecium: Bfae_14910Help
Entry
Bfae_14910        CDS       T00965                                 

Definition
(RefSeq) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00260  Glycine, serine and threonine metabolism
bfa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bfa01100  Metabolic pathways
bfa01110  Biosynthesis of secondary metabolites
bfa01130  Biosynthesis of antibiotics
bfa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bfae_14910
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bfae_14910
Enzymes [BR:bfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bfae_14910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB
Motif
Other DBs
NCBI-GeneID: 8400038
NCBI-ProteinID: YP_003154912
UniProt: C7MCL5
Position
1678790..1679623
Genome map
AA seq 277 aa AA seqDB search
MNPADTSRLRADDVLDRARAENRSALVAYLPVGFPDLDRSIEAARILIDHGADMIELGLP
YSDPVMDGAVIQQAASTALARGTRTRHVLEAVEALSGRGAAILVMSYWNPVLAYGPNAFA
RDLAAAGGAGVITPDLIPDEGADWIAASEEHAVDRVFLVAPSSPRDRLEHVVSHTRGFVY
AASTMGVTGTRASVSNATEGLVARTRAAGAKNVCVGLGVSNGEQAAEVGSYADGVIVGSA
FVRALLEHEGDDAAARTALAAVADDLRGGVERARTES
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgccgacacctcccgcctgcgcgccgacgacgtcctggaccgtgcccgggcc
gagaaccgctccgccctcgtcgcctacctgcccgtcggcttccccgacctcgaccgctcg
atcgaggcggcacggatcctcatcgaccacggcgccgacatgatcgagctcggcctgccc
tactccgaccccgtcatggacggcgccgtgatccaacaggccgcctcgaccgccctggcc
cgcggcacccgcacccgccacgtgctcgaggccgtcgaggccctctcgggccgcggcgcg
gcgatcctcgtgatgagctactggaacccggtgctggcctacggcccgaacgccttcgcc
cgcgacctcgccgccgccggcggcgcgggcgtgatcacccccgacctcatccccgacgag
ggagcggactggatcgccgcgagcgaggagcacgcggtggaccgggtgttcctcgtggcg
ccgagctctccccgcgatcgtctcgagcacgtcgtctcgcacacgcgcggcttcgtctac
gcggcgagcacgatgggcgtgaccggcacccgggcgagcgtctcgaacgccacggagggc
ctcgtcgcgcgcacccgcgcggccggggcgaagaacgtctgcgtggggctcggcgtctcg
aacggcgagcaggccgcggaggtgggctcgtacgcggacggggtgatcgtcggctccgcc
ttcgtgcgcgcgctgctcgagcacgagggcgacgacgcggcggcccgcaccgccctcgcg
gcggtggccgacgacctgcgcggcggcgtcgagcgcgcccgcaccgagagctga

DBGET integrated database retrieval system