KEGG   Brachybacterium faecium: Bfae_14910Help
Entry
Bfae_14910        CDS       T00965                                 

Definition
tryptophan synthase, alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bfa  Brachybacterium faecium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bfae_14910
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bfae_14910
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bfae_14910
Enzymes [BR:bfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bfae_14910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1678790..1679623
Genome map
AA seq 277 aa AA seqDB search
MNPADTSRLRADDVLDRARAENRSALVAYLPVGFPDLDRSIEAARILIDHGADMIELGLP
YSDPVMDGAVIQQAASTALARGTRTRHVLEAVEALSGRGAAILVMSYWNPVLAYGPNAFA
RDLAAAGGAGVITPDLIPDEGADWIAASEEHAVDRVFLVAPSSPRDRLEHVVSHTRGFVY
AASTMGVTGTRASVSNATEGLVARTRAAGAKNVCVGLGVSNGEQAAEVGSYADGVIVGSA
FVRALLEHEGDDAAARTALAAVADDLRGGVERARTES
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgccgacacctcccgcctgcgcgccgacgacgtcctggaccgtgcccgggcc
gagaaccgctccgccctcgtcgcctacctgcccgtcggcttccccgacctcgaccgctcg
atcgaggcggcacggatcctcatcgaccacggcgccgacatgatcgagctcggcctgccc
tactccgaccccgtcatggacggcgccgtgatccaacaggccgcctcgaccgccctggcc
cgcggcacccgcacccgccacgtgctcgaggccgtcgaggccctctcgggccgcggcgcg
gcgatcctcgtgatgagctactggaacccggtgctggcctacggcccgaacgccttcgcc
cgcgacctcgccgccgccggcggcgcgggcgtgatcacccccgacctcatccccgacgag
ggagcggactggatcgccgcgagcgaggagcacgcggtggaccgggtgttcctcgtggcg
ccgagctctccccgcgatcgtctcgagcacgtcgtctcgcacacgcgcggcttcgtctac
gcggcgagcacgatgggcgtgaccggcacccgggcgagcgtctcgaacgccacggagggc
ctcgtcgcgcgcacccgcgcggccggggcgaagaacgtctgcgtggggctcggcgtctcg
aacggcgagcaggccgcggaggtgggctcgtacgcggacggggtgatcgtcggctccgcc
ttcgtgcgcgcgctgctcgagcacgagggcgacgacgcggcggcccgcaccgccctcgcg
gcggtggccgacgacctgcgcggcggcgtcgagcgcgcccgcaccgagagctga

DBGET integrated database retrieval system