KEGG   Brachybacterium faecium: Bfae_15220Help
Entry
Bfae_15220        CDS       T00965                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bfa  Brachybacterium faecium
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bfae_15220
   01230 Biosynthesis of amino acids
    Bfae_15220
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bfae_15220
   00051 Fructose and mannose metabolism
    Bfae_15220
   00562 Inositol phosphate metabolism
    Bfae_15220
Enzymes [BR:bfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bfae_15220
Exosome [BR:bfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bfae_15220
  Exosomal proteins of bladder cancer cells
   Bfae_15220
  Exosomal proteins of melanoma cells
   Bfae_15220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1715209..1715985
Genome map
AA seq 258 aa AA seqDB search
MTTPRTPLMAGNWKMNLDWKQGLALVEELGEHLKEVDTSLVETVVLPPFVDLRSVQVAVD
AGKLPIAYGAQDISAHESGAYTGEVSGPMLKTLGCSYAAVGHSERRQYHGEDEEVTNAKV
KAAFAADITPILCVGEPLEERQAGKHVEYTLAQLEGGIEGLDAAQAKRIVIAYEPVWAIG
TGEVATPDDAQEVCAAIREALRAMHGDEVADAVRVLYGGSVKSANVAELMEKADVDGALV
GGASLKAEEFAKIAGFQG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccccgcaccccgctgatggcgggcaactggaagatgaacctcgactggaag
cagggcctcgccctggtcgaggagctcggcgagcacctcaaggaggtcgacacctcgctg
gtcgagaccgtcgtgctgccgcccttcgtggacctgcgcagcgtccaggtcgcggtcgac
gccggcaagctgccgatcgcgtacggcgcgcaggacatctccgcccacgagtccggtgcg
tacaccggcgaggtctccggcccgatgctgaagaccctcggctgctcctacgccgcggtc
ggccactccgagcgccgccagtaccacggcgaggacgaggaggtcacgaatgcgaaggtg
aaggccgccttcgccgcggacatcaccccgatcctgtgcgtcggcgagccgctcgaggag
cgtcaggccggcaagcacgtcgagtacaccctcgcccagctcgagggaggcatcgaggga
ctggacgccgcgcaggcgaagcggatcgtcatcgcctacgagcccgtctgggccatcggc
accggcgaggtcgccaccccggacgacgcccaggaggtgtgcgccgcgatccgtgaggcg
ctgcgtgcgatgcacggcgacgaggtcgccgacgccgtccgcgtcctgtacggcggcagc
gtgaagtccgccaacgtggccgagctcatggagaaggccgacgtcgacggcgcgctcgtc
ggcggcgcctcgctcaaggccgaggagttcgccaagatcgcgggcttccagggctga

DBGET integrated database retrieval system