KEGG   Brachybacterium faecium: Bfae_16440Help
Entry
Bfae_16440        CDS       T00965                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bfa  Brachybacterium faecium
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bfae_16440
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bfae_16440
  Amino acid metabolism
   00310 Lysine degradation
    Bfae_16440
Enzymes [BR:bfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bfae_16440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1848558..1850390
Genome map
AA seq 610 aa AA seqDB search
MSETVKMPALGESVTEGTVTRWLKSVGDTVEVDEPLLEVSTDKVDTEIPSPIAGTIEEIL
VEEDDDAEVGADLVVIGDGSGSESSDSGDSGAEETSQEEAPAESEDLASDDTVAPSTDDE
APAGESEKPAEGESSASSGEPGGAASGEDVTMPALGESVTEGTVTRWLKEVGDSVEVDEP
LLEVSTDKVDTEIPSPVAGTLLEIRVPEDEDAEVGSVLAVIGSGEAASAPAEEPSAPAPK
AEEAPAKEAPKAEEKQAEAPKAEEKPAEETTEAPKAAEQKAQEPSAPAAAPKAADAVSGA
ESSGYVTPLVRKMANEAGVDLSTVKGSGLGGRIRKQDVQQAIDAQKSAAAAPASSAPAAA
AAPAAPKVEVSSKRGTEEKMPRIRKVIGQRMMESLHEMAQLTTAVEVDLTRIAKLRARAK
DDFAAREGAKLTYLPFLMMAAIEGLKTYPQLNSTIDGDKIVYHGSENIGMAADTERGLVV
PVIKNAGDLNLAGLARQIGDLGSRAKGNKLVPDDLAGATFTITNTGSGGALWDTPIVPAP
QVGILGTGTITKRPAVVQNAEGDDTIAIRSMMYLFLSYDHRMVDGGDAARFLTFMKKRLE
EGAFEGELGL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccgtgaagatgccggcactcggcgaatccgtcaccgagggcaccgtcacc
cgctggctgaagtccgtcggcgacaccgtcgaggtggacgagccgctgctcgaggtctcg
accgacaaggtcgacaccgagatcccctcgcccatcgcgggcaccatcgaggagatcctg
gtcgaggaggacgacgacgccgaggtcggcgccgatctcgtcgtcatcggcgacggctcc
ggctccgagagctccgattccggggattccggtgccgaggagacctcccaggaggaggct
cccgccgagagcgaggacctcgcctccgacgacaccgtcgccccgtccaccgacgacgag
gccccggccggcgagtcggagaagcccgccgagggcgagagctccgcctcctccggcgag
cccggcggcgccgcctccggcgaggacgtcaccatgcccgcgctgggcgagtccgtcacc
gagggcaccgtcacccggtggctcaaggaggtcggcgacagcgtcgaggtggacgagccg
ctgctcgaggtctcgaccgacaaggtcgacaccgagatcccctcgcccgtcgcaggcacc
ctgctcgagatccgcgtcccggaggacgaggacgccgaggtcggctccgtcctggccgtg
atcggttcgggcgaggccgcgtccgctcccgccgaggagccctccgcgccggcgccgaag
gccgaggaggctcctgcgaaggaggccccgaaggccgaggagaagcaggccgaggcgccg
aaggcggaggagaagcccgccgaggagacgaccgaggcgccgaaggccgccgagcagaag
gcccaggagccctccgccccggccgccgcgccgaaggccgccgacgccgtctccggcgcc
gagtcctccggctacgtcaccccgctggtgcggaagatggccaatgaggccggcgtggac
ctctccaccgtcaagggctccggcctgggcggtcgcatccgcaagcaggacgtccagcag
gcgatcgacgcgcagaagtccgctgccgcggctcctgcctcctccgccccggccgctgct
gcggctccggcggcgccgaaggtcgaggtctcctcgaagcgcggcaccgaggagaagatg
ccgcgcatccgcaaggtcatcggccagcggatgatggagtcgctccacgagatggcccag
ctgaccacggccgtcgaggtggacctcacgcggatcgccaagctgcgtgcccgcgccaag
gacgacttcgccgcccgcgagggtgcgaagctcacctacctgccgttcctgatgatggcc
gcgatcgagggtctgaagacctacccgcagctgaactcgaccatcgacggcgacaagatc
gtctaccacggctccgagaacatcggcatggcggcggacaccgagcgcggcctcgtggtc
ccggtcatcaagaacgccggcgatctgaacctggcgggtctcgcccgtcagatcggcgat
ctcggctcgcgggccaagggcaacaagctcgtgcccgacgatctggccggcgccacgttc
acgatcacgaacaccggctcgggcggtgcgctgtgggacaccccgatcgtgccggccccg
caggtcggcatcctcggcaccggcaccatcacgaagcgtccggccgtcgtgcagaacgcc
gagggtgacgacaccatcgccatccgctcgatgatgtacctgttcctctcctacgaccac
cgcatggtcgacggcggcgacgccgcccgcttcctcaccttcatgaagaagcggctcgag
gagggcgccttcgagggcgagctcggcctgtga

DBGET integrated database retrieval system