KEGG   Brachybacterium faecium: Bfae_16440Help
Entry
Bfae_16440        CDS       T00965                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00020  Citrate cycle (TCA cycle)
bfa00310  Lysine degradation
bfa01100  Metabolic pathways
bfa01110  Biosynthesis of secondary metabolites
bfa01120  Microbial metabolism in diverse environments
bfa01130  Biosynthesis of antibiotics
bfa01200  Carbon metabolism
Module
bfa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bfa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bfae_16440
  Amino acid metabolism
   00310 Lysine degradation
    Bfae_16440
Enzymes [BR:bfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bfae_16440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Ribosomal_60s
Motif
Other DBs
NCBI-GeneID: 8400190
NCBI-ProteinID: YP_003155060
UniProt: C7MD13
Position
1848558..1850390
Genome map
AA seq 610 aa AA seqDB search
MSETVKMPALGESVTEGTVTRWLKSVGDTVEVDEPLLEVSTDKVDTEIPSPIAGTIEEIL
VEEDDDAEVGADLVVIGDGSGSESSDSGDSGAEETSQEEAPAESEDLASDDTVAPSTDDE
APAGESEKPAEGESSASSGEPGGAASGEDVTMPALGESVTEGTVTRWLKEVGDSVEVDEP
LLEVSTDKVDTEIPSPVAGTLLEIRVPEDEDAEVGSVLAVIGSGEAASAPAEEPSAPAPK
AEEAPAKEAPKAEEKQAEAPKAEEKPAEETTEAPKAAEQKAQEPSAPAAAPKAADAVSGA
ESSGYVTPLVRKMANEAGVDLSTVKGSGLGGRIRKQDVQQAIDAQKSAAAAPASSAPAAA
AAPAAPKVEVSSKRGTEEKMPRIRKVIGQRMMESLHEMAQLTTAVEVDLTRIAKLRARAK
DDFAAREGAKLTYLPFLMMAAIEGLKTYPQLNSTIDGDKIVYHGSENIGMAADTERGLVV
PVIKNAGDLNLAGLARQIGDLGSRAKGNKLVPDDLAGATFTITNTGSGGALWDTPIVPAP
QVGILGTGTITKRPAVVQNAEGDDTIAIRSMMYLFLSYDHRMVDGGDAARFLTFMKKRLE
EGAFEGELGL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccgtgaagatgccggcactcggcgaatccgtcaccgagggcaccgtcacc
cgctggctgaagtccgtcggcgacaccgtcgaggtggacgagccgctgctcgaggtctcg
accgacaaggtcgacaccgagatcccctcgcccatcgcgggcaccatcgaggagatcctg
gtcgaggaggacgacgacgccgaggtcggcgccgatctcgtcgtcatcggcgacggctcc
ggctccgagagctccgattccggggattccggtgccgaggagacctcccaggaggaggct
cccgccgagagcgaggacctcgcctccgacgacaccgtcgccccgtccaccgacgacgag
gccccggccggcgagtcggagaagcccgccgagggcgagagctccgcctcctccggcgag
cccggcggcgccgcctccggcgaggacgtcaccatgcccgcgctgggcgagtccgtcacc
gagggcaccgtcacccggtggctcaaggaggtcggcgacagcgtcgaggtggacgagccg
ctgctcgaggtctcgaccgacaaggtcgacaccgagatcccctcgcccgtcgcaggcacc
ctgctcgagatccgcgtcccggaggacgaggacgccgaggtcggctccgtcctggccgtg
atcggttcgggcgaggccgcgtccgctcccgccgaggagccctccgcgccggcgccgaag
gccgaggaggctcctgcgaaggaggccccgaaggccgaggagaagcaggccgaggcgccg
aaggcggaggagaagcccgccgaggagacgaccgaggcgccgaaggccgccgagcagaag
gcccaggagccctccgccccggccgccgcgccgaaggccgccgacgccgtctccggcgcc
gagtcctccggctacgtcaccccgctggtgcggaagatggccaatgaggccggcgtggac
ctctccaccgtcaagggctccggcctgggcggtcgcatccgcaagcaggacgtccagcag
gcgatcgacgcgcagaagtccgctgccgcggctcctgcctcctccgccccggccgctgct
gcggctccggcggcgccgaaggtcgaggtctcctcgaagcgcggcaccgaggagaagatg
ccgcgcatccgcaaggtcatcggccagcggatgatggagtcgctccacgagatggcccag
ctgaccacggccgtcgaggtggacctcacgcggatcgccaagctgcgtgcccgcgccaag
gacgacttcgccgcccgcgagggtgcgaagctcacctacctgccgttcctgatgatggcc
gcgatcgagggtctgaagacctacccgcagctgaactcgaccatcgacggcgacaagatc
gtctaccacggctccgagaacatcggcatggcggcggacaccgagcgcggcctcgtggtc
ccggtcatcaagaacgccggcgatctgaacctggcgggtctcgcccgtcagatcggcgat
ctcggctcgcgggccaagggcaacaagctcgtgcccgacgatctggccggcgccacgttc
acgatcacgaacaccggctcgggcggtgcgctgtgggacaccccgatcgtgccggccccg
caggtcggcatcctcggcaccggcaccatcacgaagcgtccggccgtcgtgcagaacgcc
gagggtgacgacaccatcgccatccgctcgatgatgtacctgttcctctcctacgaccac
cgcatggtcgacggcggcgacgccgcccgcttcctcaccttcatgaagaagcggctcgag
gagggcgccttcgagggcgagctcggcctgtga

DBGET integrated database retrieval system