KEGG   Brachybacterium faecium: Bfae_16630Help
Entry
Bfae_16630        CDS       T00965                                 

Definition
Polyphosphate glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
bfa  Brachybacterium faecium
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:bfa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bfa00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bfa00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1870306..1871154
Genome map
AA seq 282 aa AA seqDB search
MSKQAFGIDIGGSGIKGAPVDLSTGELAADRLRIETPQPSTPDAVADTVAELISSFDVAP
DMPVGVTFPAVIQAGVAQTAANVDDAWIGTDVDALLTERTGHDVFVVNDADAAGIAEMKF
GAGRKSTGVVLVITLGTGVGSATFVDGTLVPNTELGHVLLHGDSAERYMASSIREKEDLD
WETWAARLQEYFSHIEFLFSPTRLIVGGGVSKKHKHFLPLLDLKSEIVPAKLRNEAGIVG
AAVLAHREEKALRKAAKKAGSSENTADAAGAKKEKTKTKAAK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcaggccttcgggatcgacatcggcgggagcgggatcaagggggctccggtc
gatctctccaccggggagctcgccgccgacaggctgcggatcgagactccgcagccctcg
accccggatgccgtggcggacaccgtcgccgagctcatctcctccttcgacgtcgcgccg
gacatgcccgtgggcgtcaccttccccgcggtgatccaggcgggggtcgcccagaccgcg
gccaacgtggacgatgcgtggatcgggaccgatgtggacgccctgctcaccgagcgcacc
ggtcacgacgtgttcgtcgtcaacgacgccgacgccgccgggatcgcggagatgaagttc
ggggcgggccggaagtccaccggcgtggtcctcgtgatcacgctcggcaccggcgtgggc
agcgcgaccttcgtggacggcaccctggtgcccaacaccgagctcggccacgtgctgctg
cacggcgactccgccgagcgctacatggccagctccatccgggagaaggaggatctggac
tgggagacctgggcggcgcggctccaggaatacttctcccacatcgagttcctcttcagc
cccactcgcctcatcgtgggcggaggggtctcgaagaagcacaagcacttcctgccgctg
ctggatctgaagagcgagatcgtgccggcgaagctgcgcaacgaggccgggatcgtcggt
gccgccgtgctcgcgcaccgcgaggagaaggccctgcggaaggccgcgaagaaggcgggg
agctccgagaacacggcggacgcggccggcgcgaagaaggagaagaccaagaccaaggcg
gcgaagtag

DBGET integrated database retrieval system