KEGG   Brachybacterium faecium: Bfae_16630Help
Entry
Bfae_16630        CDS       T00965                                 

Definition
(RefSeq) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bfa  Brachybacterium faecium
Pathway
bfa00010  Glycolysis / Gluconeogenesis
bfa00520  Amino sugar and nucleotide sugar metabolism
bfa01100  Metabolic pathways
bfa01110  Biosynthesis of secondary metabolites
bfa01120  Microbial metabolism in diverse environments
bfa01130  Biosynthesis of antibiotics
bfa01200  Carbon metabolism
Module
bfa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bfae_16630
   00520 Amino sugar and nucleotide sugar metabolism
    Bfae_16630
Enzymes [BR:bfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Bfae_16630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-GeneID: 8400209
NCBI-ProteinID: YP_003155079
UniProt: C7MD32
Position
1870306..1871154
Genome map
AA seq 282 aa AA seqDB search
MSKQAFGIDIGGSGIKGAPVDLSTGELAADRLRIETPQPSTPDAVADTVAELISSFDVAP
DMPVGVTFPAVIQAGVAQTAANVDDAWIGTDVDALLTERTGHDVFVVNDADAAGIAEMKF
GAGRKSTGVVLVITLGTGVGSATFVDGTLVPNTELGHVLLHGDSAERYMASSIREKEDLD
WETWAARLQEYFSHIEFLFSPTRLIVGGGVSKKHKHFLPLLDLKSEIVPAKLRNEAGIVG
AAVLAHREEKALRKAAKKAGSSENTADAAGAKKEKTKTKAAK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcaggccttcgggatcgacatcggcgggagcgggatcaagggggctccggtc
gatctctccaccggggagctcgccgccgacaggctgcggatcgagactccgcagccctcg
accccggatgccgtggcggacaccgtcgccgagctcatctcctccttcgacgtcgcgccg
gacatgcccgtgggcgtcaccttccccgcggtgatccaggcgggggtcgcccagaccgcg
gccaacgtggacgatgcgtggatcgggaccgatgtggacgccctgctcaccgagcgcacc
ggtcacgacgtgttcgtcgtcaacgacgccgacgccgccgggatcgcggagatgaagttc
ggggcgggccggaagtccaccggcgtggtcctcgtgatcacgctcggcaccggcgtgggc
agcgcgaccttcgtggacggcaccctggtgcccaacaccgagctcggccacgtgctgctg
cacggcgactccgccgagcgctacatggccagctccatccgggagaaggaggatctggac
tgggagacctgggcggcgcggctccaggaatacttctcccacatcgagttcctcttcagc
cccactcgcctcatcgtgggcggaggggtctcgaagaagcacaagcacttcctgccgctg
ctggatctgaagagcgagatcgtgccggcgaagctgcgcaacgaggccgggatcgtcggt
gccgccgtgctcgcgcaccgcgaggagaaggccctgcggaaggccgcgaagaaggcgggg
agctccgagaacacggcggacgcggccggcgcgaagaaggagaagaccaagaccaaggcg
gcgaagtag

DBGET integrated database retrieval system