KEGG   Brachybacterium faecium: Bfae_17050Help
Entry
Bfae_17050        CDS       T00965                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bfa  Brachybacterium faecium
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bfae_17050
Enzymes [BR:bfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Bfae_17050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1907424..1909484
Genome map
AA seq 686 aa AA seqDB search
MTSATPASSAARRPFDPGALLFGGDYNPDQWPREIWEEDIELMTRARVNTVTLTVFSWSR
LEPTEGSYDFAWLDDAIAMLTQAGVGFFLSTPTASPPPWFSLAHPDAMPVRPDGTVLSHG
SRDTYAISAPAYREACRRIARALAERYGAHPGLRGWHVHNEYGTLDHGPHAARAFRRWLR
ERYGTVEALNEAWTTAFWSQRYSSFDEVRPPLATQYLDNPSHAVDFRRFASDEMLAAMCE
QRDEIRATGSTAPITTNFMLPTWNHLEQWAWAEQQDVVSVDHYLDTAGPDGEAHVAYGSD
LTRSWAGGEPWVLMEQNARGIITADRTYAKTPSRMLRNSLGYIARGSQTAMFFQWRASTG
GAEQWHGALVPHAGGDDELFAPVVELGRILEAISEVTAPPTDGILHHADVGILWHADSWW
TLETPSMPHDGLPYREEVRAAHRSFWRAGIATDFVRPGADASRYRLLVVPALIAMSTKTA
AWLRDYVEAGGRLVVTYLSALTDENQRVGLGGYPAVLRELLGITVSELLPLAPEEAVHLD
DGSRASEWVERVRLADASALTSYRDGPVAGRPAVTSVARGRGAAVYLSARLVQEDRDALL
LAQAQEAGIGPVLPGASGLGVEAVRRRGATADYLFLLHHGQGDVIVRGEGTELVSGARTA
DGVRLDAGGVAVVRVERAAGLEVAPA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgccacccccgcctcctccgccgcccgccggccgttcgaccccggcgcgctg
ctgttcggcggcgactacaaccccgaccagtggccgcgggagatctgggaggaggacatc
gagctgatgacccgggcacgggtcaacaccgtcaccctcaccgtgttctcgtggtcccgg
ctggagccgacggagggcagctacgacttcgcctggctcgatgacgcgatcgcgatgctc
acgcaggcgggcgtcgggttcttcctgtccacccccaccgcctctcccccgccgtggttc
agcctcgcccaccccgacgcgatgccggtacggcccgacggcacggtgctcagccacgga
tcccgggacacctacgccatcagcgcccccgcctaccgcgaggcgtgccggcgcatcgcc
cgcgccctcgccgagcgctacggcgcgcacccgggactgcgcggctggcacgtgcacaac
gagtacgggacgctcgatcacgggccgcacgcggcgcgcgccttccgccggtggctgcgt
gagcggtacgggacggtcgaggcgctcaacgaggcctggaccaccgccttctggtcgcag
cgctactccagcttcgacgaggtgcgcccgcctctggccacgcagtacctcgacaacccc
tcccacgccgtcgacttccgccggttcgcctccgacgagatgctcgcggcgatgtgcgag
cagcgtgacgagatccgggccaccggctccaccgcacccatcaccacgaacttcatgctc
cccacctggaaccacctcgagcagtgggcgtgggccgagcagcaggacgtcgtctcggtc
gaccactacctggacaccgcggggccggatggcgaagcgcacgtggcctacggcagcgac
ctgacccgctcctgggccgggggcgagccgtgggtgctcatggagcagaacgcgcgcggc
atcatcaccgccgaccgcacctacgccaagacgccctcgcggatgctccgcaacagcctg
ggatacatcgcccgcggctcgcagaccgcgatgttcttccagtggcgggccagcacggga
ggcgccgagcagtggcacggcgcgctcgtgccccacgccggaggggacgacgagctgttc
gcgcccgtggtcgagctcgggcggatcctggaagcgatctccgaggtgaccgctccgccc
acggacggcatcctccatcacgccgacgtcggcatcctctggcacgccgactcctggtgg
acgctcgagacgccgagcatgccgcatgacggcctgccctaccgcgaggaggtgcgcgcg
gcgcaccgctccttctggcgtgcgggcatcgccaccgatttcgtgcgcccgggcgcagat
gcctcgcgctaccggctcctggtggtccccgcgctgatcgccatgtcgacgaagacggcc
gcgtggctgcgcgactatgtcgaggccggggggcggctcgtggtcacctacctctcggcc
ctcaccgacgagaaccagcgcgtgggcctcggcggctacccggccgtgctgcgcgagctg
ctcgggatcacggtgtccgagctgctgccgctggccccggaggaggctgtgcatctcgac
gacggctcccgcgcctcggagtgggtcgagcgggtgcggctcgccgacgcgagcgcgctg
acctcttaccgggacggcccggtggcgggacggccggccgtgacctcggtcgcgcggggc
cgcggcgccgcggtgtacctctccgcccgcctcgtgcaggaggatcgcgatgccctcctc
ctggcccaggcgcaggaggccggcatcggcccggtcctgcccggtgcgagcgggctcggc
gtcgaggcggtgcggcggcgcggtgcgacggcggactatctgttcctgctccaccacggg
cagggggacgtcatcgtgcggggcgaggggacggagctggtcagcggggcccgcaccgcc
gacggggtgcggctggacgcgggcggcgtcgccgtggtgcgtgtggagcgcgcggccggg
ctcgaggtggcgccggcctga

DBGET integrated database retrieval system