KEGG   Brachybacterium faecium: Bfae_17530Help
Entry
Bfae_17530        CDS       T00965                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bfa  Brachybacterium faecium
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bfae_17530
   00052 Galactose metabolism
    Bfae_17530
   00500 Starch and sucrose metabolism
    Bfae_17530
   00520 Amino sugar and nucleotide sugar metabolism
    Bfae_17530
Enzymes [BR:bfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bfae_17530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1962782..1964170)
Genome map
AA seq 462 aa AA seqDB search
MSTEGLAAAQRKMADDGVAQTAIDVFSHYYGQLEDGVTGTIPEDTIEPYLDPPLLEDVKI
DVGEAKQVFDQLAIINLNGGLGTSMGLDQAKSLLPVRDGKSFLDIIVEQVLAARRGTGSR
LPLIFMNSFRTREDTLEVLSKYPDLPVGDLPLDFLQNKEPKLRQDDLTPVDWEADPDLEW
CPPGHGDIYTALQTSGLLQQLLDAGFKYASVSNSDNLGTVPSPVIAAWFAATGAPYAAEL
CRRTPADRKGGHLAVRKSDGRLILRDTAQTPAEEMDYFTDEHRHPFFHTNNLWFDLEQMA
AVLAERDGIMGLPLIRNEKTVDPADKTSTPVYQIESAMGAAIEVFDGATAIVVGRDRFLP
VKATSDLLLVRSDAYALDERAALVQQVENVPTVSLQAGSYKLIQDFEPRFPYGVPSLKDA
SSLEVQGDWTFGADVTVIGDAVLGEEGGEVPEGARVGTASTS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagaaggacttgccgcagcgcagaggaagatggccgacgacggggtcgcacag
accgcgatcgacgtcttctcccattactacggtcagctcgaggacggcgtcaccggcacg
atccccgaggacacgatcgagccgtacctcgacccgccgctgctcgaggacgtgaagatc
gatgtgggcgaggccaagcaggtcttcgaccagctggcgatcatcaacctcaacggcggg
ctcggcacctcgatgggcctggaccaggccaagtcgctgctgcccgtgcgggacggcaaa
tcgttcctggacatcatcgtggagcaggtcctcgccgcccgtcgcggcaccgggtcgcgt
ctgccgctgatcttcatgaactccttccgcacccgggaggacaccctcgaggtgctctcg
aagtaccccgatctcccggtcggcgacctgccgctggacttcctgcagaacaaggagccc
aagctccgccaggacgacctcaccccggtggactgggaggcagatcctgatctcgagtgg
tgcccgcccggccacggcgacatctacaccgcgctgcagacctccggcctgctccagcag
ctgctggacgccggtttcaagtacgcctccgtctccaactcggacaacctcggcaccgtc
ccgagcccggtgatcgccgcctggttcgccgccaccggcgcgccctacgccgcggagctg
tgccgccgcacgcccgccgaccgcaagggcgggcacctggcggtgcgcaagtccgacggg
cggctcatcctgcgcgacaccgcgcagaccccggccgaggagatggactacttcaccgat
gagcaccgccacccgttcttccacacgaacaacctctggttcgacctcgagcagatggcg
gcggtgctcgccgagcgcgacgggatcatgggcctgccgctgatccgcaacgagaagacg
gtggacccggccgacaagaccagcacccccgtctaccagatcgagtccgcgatgggcgcc
gcgatcgaggtgttcgacggcgcgaccgcgatcgtggtgggccgcgaccgcttcctgccg
gtgaaggcgacctccgatctgctgctggtgcgctcggacgcctacgcgctcgacgagcgg
gccgcgctcgtgcagcaggtcgagaacgtgccgacggtgtcgctgcaggccgggtcctac
aagctcatccaggacttcgagccgcgcttcccctacggcgtgccctcgctcaaggacgct
tcgagcctcgaggtgcagggcgactggaccttcggcgccgacgtgaccgtgatcggcgat
gcggtgctcggcgaggaaggcggcgaggtgccggagggcgcccgcgtcggcaccgcctcg
accagctga

DBGET integrated database retrieval system