KEGG   Brachybacterium faecium: Bfae_19050Help
Entry
Bfae_19050        CDS       T00965                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bfa  Brachybacterium faecium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bfae_19050
Enzymes [BR:bfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Bfae_19050
Exosome [BR:bfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bfae_19050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2139133..2141331
Genome map
AA seq 732 aa AA seqDB search
MTETPAPAVPVMPLGEHELGATATGSYHDPHSVLGAHEYAGGVTVRTLAPLAHEVAVLLP
DGTAVPMEHEYDGIWVVALARPELPSHRLRVTWTQGAEPVELEEPYRFLPTIGELDLHLI
REGRHEELWRALGAHLATLDGVEGTSFAVWAPNARAVQVVGSFNGWDGRLHALRSLGASG
VWEVFVPGPGEGDVYKFRILGADGVWRDKADPMARFAEVPPATGSVITHSDFEWTDDHWL
AERAAGDPLSSRMSVYEVHLPSWRPGLGYRELATELTDYVREMGFTHVELMPVSEHPFGG
SWGYQVTGYYAPTSRLGSPDELRHLIDTLHGAGIGVLLDWVPAHFPKDEWALGRFDGTPL
YEHADPRRGEHPDWGTYIFDTGRNEVRNFLVANACYWLEEFHVDGLRVDAVASMLYLDYS
REDGQWVPNRHGGREDLENIAFLQEATATAYKRAPGIVMIAEESTSFPGVTRPTDAGGLG
FGFKWNMGWMHDTLQYLGQDPVHRQHHHGELTFSMVYQYSENFVLPLSHDEVVHGKGSLL
RKAPGDDWQQAATLRSYLAFQWTHPGKQLVFMGIEFAQGTEWSEQAGLPWWLLEYPLHRG
AQQLVRDLNAVQEEFPALYERDQDPGGFEWLIGDDAAHNTLSFARRDAAGDPVVVVVNFS
AEPWHEYRIPLPEGGDWLEVLNSDAPVYGGSGVGNLGRVHAEQLPLHGREHSVRLSLPPL
GAVILVPSRLRD
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagacccccgcccccgccgtcccggtgatgccgctgggagagcacgagctcggc
gccaccgcgaccggcagctaccacgacccccactcggtgctcggcgcccacgagtacgcc
ggcggcgtcaccgtgcgcaccctcgcgccgctcgcgcacgaggtcgccgtgctcctgccc
gacgggaccgcggtcccgatggagcacgagtacgacgggatctgggtcgtcgcgctcgcg
aggccggagctgccctcgcaccggctgcgcgtcacctggacgcagggcgcggagccggtc
gagctcgaggagccgtaccgcttcctgcccaccatcggcgagctggacctccacctgatc
cgcgagggtcggcacgaggagctgtggcgggcgctcggcgcgcacctggccaccctcgac
ggggtggagggcacctccttcgccgtctgggcgccgaacgcgcgcgctgtgcaggtggtc
ggctccttcaacggctgggacgggcgcctgcacgcgctgcgctccctcggcgcctcgggc
gtgtgggaggtgttcgtgcccggccccggtgagggggacgtctacaagttccgcatcctc
ggcgccgacggcgtgtggcgggacaaggccgatccgatggcccgcttcgcggaggtgccg
cccgcgaccggttccgtgatcacccacagcgacttcgagtggaccgacgaccactggctc
gccgagcgcgcggccggtgatcccctctcctcgcggatgtcggtctacgaggtgcacctg
cccagctggcggccggggctgggctatcgggagctcgccaccgagctcaccgactacgtg
cgggagatgggcttcacgcatgtggagctcatgccggtgtcggagcatcccttcggcgga
tcctggggctaccaggtcaccgggtactacgcacccacctcccggctgggcagccccgac
gagctgcggcacctcatcgacaccctccacggtgccgggatcggcgtgctcctggactgg
gtgcccgcccacttccccaaggacgagtgggcgctgggccgcttcgacggcactcccctg
tacgagcacgcggatccgcgccgcggcgagcatccggactggggcacctacatcttcgac
accgggcgcaacgaggtgcgcaacttcctggtcgccaacgcctgctactggctcgaggag
ttccacgtcgacggtctgcgggtcgatgcggtcgcctcgatgctgtacctggactactcc
cgcgaggacgggcagtgggtcccgaaccgtcacggcgggcgcgaggatctcgagaacatc
gccttcctccaggaggcgacggccaccgcgtacaagcgtgcgccggggatcgtgatgatc
gccgaggagtccacctcgttcccgggcgtcacccgccccacggatgccggcggcctcgga
ttcggcttcaagtggaacatgggctggatgcacgacaccctccagtacctggggcaggat
ccggtgcaccgccagcaccaccacggcgagctgaccttctcgatggtctaccagtactcc
gagaacttcgtgctgccgctgagccacgacgaggtcgtccacggcaaggggtcgctgctg
cgcaaggccccgggcgacgactggcagcaggccgcgacgctgcgctcctatctcgcgttc
cagtggacccatcccggcaagcagctggtgttcatgggcatcgagttcgcgcagggcacc
gagtggtccgaacaggcggggctgccctggtggctgctggagtacccgttgcaccgcggg
gcgcagcagctggtgcgggatctgaacgccgtgcaggaggagttcccggcgctctacgag
cgggaccaggatccgggcggtttcgaatggctgatcggggatgacgccgcgcacaacacg
ctgtccttcgcgcgccgcgacgccgcgggggatccggtggtggtggtcgtgaacttctcg
gcggagccctggcacgagtaccggatcccgctgcccgagggcggggactggctcgaggtg
ctcaactccgatgcgcccgtctacggcggcagcggggtcggcaacctggggcgggtccat
gccgagcagctgcccctgcacgggcgggagcactcggtgcggctgtcgctgccgccgctg
ggcgcggtgatcctcgtcccgtcccggctgcgggactga

DBGET integrated database retrieval system