KEGG   Brachybacterium faecium: Bfae_19330Help
Entry
Bfae_19330        CDS       T00965                                 

Definition
L-threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bfa  Brachybacterium faecium
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bfae_19330
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bfae_19330
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bfae_19330
Enzymes [BR:bfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bfae_19330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2169937..2170995)
Genome map
AA seq 352 aa AA seqDB search
MAHQWRGVLAEYREHLPFAEGDTLLTLGEGGTPLVPAPALSQAVGADVHIKVEGMNPTGS
FKDRGMVSAMSKAVNDGASAVVCASTGNTSASAAAYATAAGLTCAVLLPQGKIAAGKLAQ
AVVHGAKLIQVDGNFDDCLEIARKLEAEHPIELVNSVNPYRLQGQKTAAFEVSDALGRAP
DIHVLPVGNAGNISAYWMGYREYREAGVTDALPQMWGFQAAGAAPFAAGHPITDPETIAT
AIRIGAPASWHLAVEARDDSGGLIDAVSDQQILDAQTLLAAEVGIFVEPASAAGVAGLLQ
QSHRGLVPAGATIAITVTGNGLKDIDTALTQHDLTPTVVPVDIVAAAEAIGL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcagtggcgcggcgtcctcgccgagtaccgcgagcacctcccgttcgccgag
ggcgacaccctcctcacgctgggggagggaggcaccccgctggtgcccgcgcccgccctg
tcgcaggccgtgggagcggacgtccacatcaaggtcgaggggatgaaccccaccggctcg
ttcaaggaccgcggcatggtctcggcgatgtcgaaggccgtgaacgacggggcgagcgcc
gtggtgtgcgcctccaccggcaacaccagcgcctcggccgccgcctacgccaccgccgcc
gggctcacctgcgcggtgctgctgccgcagggcaagatcgcggccggcaagctcgcccag
gccgtggtgcacggggcgaagctcatccaggtcgacggcaacttcgacgactgcctcgag
atcgcccgcaagctcgaggcggagcacccgatcgagctggtcaactcggtgaacccgtac
cgcctccagggccagaagaccgccgccttcgaggtgagcgatgcgctgggccgcgcaccg
gacatccacgtcctgccggtcggcaacgccgggaacatctccgcctactggatgggctac
cgcgaataccgcgaggcgggcgtgaccgacgcgctgccgcagatgtggggcttccaggcc
gccggcgccgcccccttcgcagccggccacccgatcaccgacccggagacgatcgcgacc
gcgatccgcatcggcgcgccggcctcctggcatctcgcggtcgaggcccgtgacgactcg
ggcggtctcatcgacgcggtcagcgatcagcagatcctcgacgcccagacgctgctcgcg
gcggaggtcgggatcttcgtcgagcccgcgtcggcggccggcgtggccgggctgctgcag
cagtcgcatcgcggcctggtgcccgcaggggcgacgatcgcgatcaccgtgacgggcaac
ggcctgaaggacatcgacaccgcgctgacccagcacgacctcaccccgaccgtggtgccg
gtggacatcgtcgcagcggctgaggccatcggcctgtga

DBGET integrated database retrieval system