KEGG   Brachybacterium faecium: Bfae_19330Help
Entry
Bfae_19330        CDS       T00965                                 

Definition
(RefSeq) L-threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bfa  Brachybacterium faecium
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bfae_19330
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bfae_19330
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bfae_19330
Enzymes [BR:bfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bfae_19330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2169937..2170995)
Genome map
AA seq 352 aa AA seqDB search
MAHQWRGVLAEYREHLPFAEGDTLLTLGEGGTPLVPAPALSQAVGADVHIKVEGMNPTGS
FKDRGMVSAMSKAVNDGASAVVCASTGNTSASAAAYATAAGLTCAVLLPQGKIAAGKLAQ
AVVHGAKLIQVDGNFDDCLEIARKLEAEHPIELVNSVNPYRLQGQKTAAFEVSDALGRAP
DIHVLPVGNAGNISAYWMGYREYREAGVTDALPQMWGFQAAGAAPFAAGHPITDPETIAT
AIRIGAPASWHLAVEARDDSGGLIDAVSDQQILDAQTLLAAEVGIFVEPASAAGVAGLLQ
QSHRGLVPAGATIAITVTGNGLKDIDTALTQHDLTPTVVPVDIVAAAEAIGL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcagtggcgcggcgtcctcgccgagtaccgcgagcacctcccgttcgccgag
ggcgacaccctcctcacgctgggggagggaggcaccccgctggtgcccgcgcccgccctg
tcgcaggccgtgggagcggacgtccacatcaaggtcgaggggatgaaccccaccggctcg
ttcaaggaccgcggcatggtctcggcgatgtcgaaggccgtgaacgacggggcgagcgcc
gtggtgtgcgcctccaccggcaacaccagcgcctcggccgccgcctacgccaccgccgcc
gggctcacctgcgcggtgctgctgccgcagggcaagatcgcggccggcaagctcgcccag
gccgtggtgcacggggcgaagctcatccaggtcgacggcaacttcgacgactgcctcgag
atcgcccgcaagctcgaggcggagcacccgatcgagctggtcaactcggtgaacccgtac
cgcctccagggccagaagaccgccgccttcgaggtgagcgatgcgctgggccgcgcaccg
gacatccacgtcctgccggtcggcaacgccgggaacatctccgcctactggatgggctac
cgcgaataccgcgaggcgggcgtgaccgacgcgctgccgcagatgtggggcttccaggcc
gccggcgccgcccccttcgcagccggccacccgatcaccgacccggagacgatcgcgacc
gcgatccgcatcggcgcgccggcctcctggcatctcgcggtcgaggcccgtgacgactcg
ggcggtctcatcgacgcggtcagcgatcagcagatcctcgacgcccagacgctgctcgcg
gcggaggtcgggatcttcgtcgagcccgcgtcggcggccggcgtggccgggctgctgcag
cagtcgcatcgcggcctggtgcccgcaggggcgacgatcgcgatcaccgtgacgggcaac
ggcctgaaggacatcgacaccgcgctgacccagcacgacctcaccccgaccgtggtgccg
gtggacatcgtcgcagcggctgaggccatcggcctgtga

DBGET integrated database retrieval system