KEGG   Brachybacterium faecium: Bfae_19590Help
Entry
Bfae_19590        CDS       T00965                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K05522  
endonuclease VIII [EC:3.2.2.- 4.2.99.18]
Organism
bfa  Brachybacterium faecium
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bfa03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2204801..2205688
Genome map
AA seq 295 aa AA seqDB search
MPEGDTVARQCRILHEALAGATLTGCDLRVPRAATADLVGWCVQEVRPRGKHLLLRLLPP
SPGAVPLTLHTHLMMDGIWHVDGRALRSSDTSAGPRPAATIRAVLTARHEDGRQTRAIAY
DVKQVRLVRTADEDSLVGHLGPDLLDPLWDDAHRERAVQNLAAEPEREIGLALLDQRNLA
GIGNIYRSELCFLRRVHPAAPTGSAGDLRGFVDLAHRLLVLNQDRAVRVTTGGMLGRDGD
LWVYGRGGRQCRRCRARIQRGELGDPRLEGTEPRVLWFCPRCQVGPGAPARGTGR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgccggagggggacaccgtcgcccggcagtgccggatcctgcacgaggccctcgccggg
gccacgctcaccgggtgcgatctgcgggtgccgcgcgccgcgacggcggatctcgtcggc
tggtgcgtgcaggaggtgcgcccgcgcggcaagcatctgctgctgcggctgctcccgccc
tcccccggagcggtcccgctgacgctgcacacgcatctcatgatggacgggatctggcac
gtcgacggcagggcgctgcgttcgagcgacaccagcgcagggccccgccccgccgccacg
atccgtgccgtgctcaccgcccgccatgaggacggtcgccagacgcgggcgatcgcatat
gacgtgaagcaggtgcgcctggtgcgcacggccgacgaggactcgctcgtgggccacctc
ggcccggatctgctggatccgctgtgggacgacgcccaccgggaacgggcggtgcagaac
ctcgccgccgagccggagcgagagatcggcctcgctctgctcgatcagcgcaacctcgcc
gggatcggcaacatctaccgcagcgaactgtgcttcctgcgccgcgtccaccccgccgcg
ccgaccgggagcgcgggtgatctgcgcgggttcgtcgacctcgcgcaccggctgctggtg
ctgaaccaggaccgggccgtgcgggtcaccaccggcgggatgctgggccgggacggagac
ctgtgggtctacggccgcggaggccggcagtgccgccgctgccgcgcccggatccagcgc
ggcgagctcggcgacccgcgtctggagggcaccgagccccgcgtgctgtggttctgcccg
cgctgccaggtgggcccgggagcaccggcccgcgggacaggtcggtag

DBGET integrated database retrieval system