KEGG   Brachybacterium faecium: Bfae_19590Help
Entry
Bfae_19590        CDS       T00965                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K05522  
endonuclease VIII [EC:3.2.2.- 4.2.99.18]
Organism
bfa  Brachybacterium faecium
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Bfae_19590
Enzymes [BR:bfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Bfae_19590
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Bfae_19590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2204801..2205688
Genome map
AA seq 295 aa AA seqDB search
MPEGDTVARQCRILHEALAGATLTGCDLRVPRAATADLVGWCVQEVRPRGKHLLLRLLPP
SPGAVPLTLHTHLMMDGIWHVDGRALRSSDTSAGPRPAATIRAVLTARHEDGRQTRAIAY
DVKQVRLVRTADEDSLVGHLGPDLLDPLWDDAHRERAVQNLAAEPEREIGLALLDQRNLA
GIGNIYRSELCFLRRVHPAAPTGSAGDLRGFVDLAHRLLVLNQDRAVRVTTGGMLGRDGD
LWVYGRGGRQCRRCRARIQRGELGDPRLEGTEPRVLWFCPRCQVGPGAPARGTGR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgccggagggggacaccgtcgcccggcagtgccggatcctgcacgaggccctcgccggg
gccacgctcaccgggtgcgatctgcgggtgccgcgcgccgcgacggcggatctcgtcggc
tggtgcgtgcaggaggtgcgcccgcgcggcaagcatctgctgctgcggctgctcccgccc
tcccccggagcggtcccgctgacgctgcacacgcatctcatgatggacgggatctggcac
gtcgacggcagggcgctgcgttcgagcgacaccagcgcagggccccgccccgccgccacg
atccgtgccgtgctcaccgcccgccatgaggacggtcgccagacgcgggcgatcgcatat
gacgtgaagcaggtgcgcctggtgcgcacggccgacgaggactcgctcgtgggccacctc
ggcccggatctgctggatccgctgtgggacgacgcccaccgggaacgggcggtgcagaac
ctcgccgccgagccggagcgagagatcggcctcgctctgctcgatcagcgcaacctcgcc
gggatcggcaacatctaccgcagcgaactgtgcttcctgcgccgcgtccaccccgccgcg
ccgaccgggagcgcgggtgatctgcgcgggttcgtcgacctcgcgcaccggctgctggtg
ctgaaccaggaccgggccgtgcgggtcaccaccggcgggatgctgggccgggacggagac
ctgtgggtctacggccgcggaggccggcagtgccgccgctgccgcgcccggatccagcgc
ggcgagctcggcgacccgcgtctggagggcaccgagccccgcgtgctgtggttctgcccg
cgctgccaggtgggcccgggagcaccggcccgcgggacaggtcggtag

DBGET integrated database retrieval system