KEGG   Brachybacterium faecium: Bfae_20800Help
Entry
Bfae_20800        CDS       T00965                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
bfa  Brachybacterium faecium
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:bfa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2326891..2328018
Genome map
AA seq 375 aa AA seqDB search
MSTAHPPAQAVPPPGPEPSTSGDAAPPAGIAVLPVTGLGEIREGDDLAKLLARALAPLSP
QDGDVLCVSTKIVSKALGLRIAAEERDRAIAAAAVRTVARRLHTRVVTSVVQIPSGPVMA
AAGVDSSNAPDGPLLLPEDPDACARDLHRGIAAELGVEVGVLLTDTSSRIWRVGVGDIAL
GAAGVASLQDLRGGVDADGRPLTVTVRNLADELAAAADLVKGKASGVPAALVRGVPGATA
GEVPARELSRTGPDDWFRRPSLESVWVALGLSPAQEPVARMSPEPAQERIARALEVAAVP
RDGRPSARARARLSTEADGSAHIVVETVDGSRQSLIDAATLAERIRTALGAESLGAPLPA
VTVEIADPDPLEDLS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaccgctcatccccctgcccaggccgtcccgccacccggccccgagccctcgacc
tccggtgatgcggccccgcccgccggcatcgccgtgctgcccgtcaccggtctcggcgag
atccgcgagggcgatgacctcgcgaagctgctggcgcgcgccctcgcgcccctgtccccg
caggacggcgacgtgctgtgcgtctccaccaagatcgtctccaaggcgctggggctgcgc
atcgccgccgaggagcgggaccgggcgatcgccgcagcggccgtgcgcaccgtcgcccgg
cgcctgcacacccgcgtggtgacctcggtggtgcagatcccctccggcccggtcatggcc
gcggccggcgtggactcctccaacgcgcccgacggtccgctgctgctgcccgaggacccg
gacgcctgcgcccgggacctgcaccgcgggatcgccgccgagctcggggtcgaggtgggg
gtgctgctgaccgacacctcctcccgcatctggcgggtgggagtgggggacatcgcgctc
ggcgcggccggggtggcctcgctgcaggatctgcgcggaggggtcgatgccgacggccgc
cccctcaccgtcacggtgcggaacctcgccgacgagctcgcagcggcggcggacctggtc
aagggcaaggcgagcggggtgccggcggcgctcgtgcgcggcgtgcccggcgcgacggcg
ggcgaggtcccggcccgtgagctctcgcgcaccgggcccgacgactggttccgccgcccc
agcctcgaatcggtgtgggtcgcgctgggcctctcccccgcccaggaaccggtggcgcgg
atgtcccccgaaccggcccaggagcggatcgcgcgggcgctcgaggtcgcggccgtaccg
cgcgacgggcggccctccgcgagggcgcgggcccgcctgagcacggaggccgacggctca
gcgcatatcgtggtggagaccgtcgacggttcccggcagtcgctgatcgatgcggcgacc
ctcgccgagcggatccgcaccgcgctgggggccgagtccctcggcgcaccgctgcccgcc
gtcaccgtcgagatcgccgaccccgaccccctggaggacctgtcatga

DBGET integrated database retrieval system