KEGG   Brachybacterium faecium: Bfae_21230Help
Entry
Bfae_21230        CDS       T00965                                 

Definition
thymidine phosphorylase (EC:2.4.2.2)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bfa  Brachybacterium faecium
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bfa00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2379868..2381181)
Genome map
AA seq 437 aa AA seqDB search
MTDATADPAVEPFDVVDVIRTKRDGGRLEGGQIDWVIDAYTRGVVAEEQMAALAMAIFLR
GMERPEIARWTSAMIDTGERMDFSALSKPTTDKHSTGGVGDKITLPLAPLVASFGVAVPQ
LSGRGLGHTGGTLDKLEAIPGWRAALTNDEMMAQLESVGAVICAAGSGLAPADKKLYALR
DVTGTVEAIPLIASSIMSKKIAEGTAALTLDVKTGAGAFMKDEADARELARTMVELGTDA
GTRTVALLTDMSAPLGRTAGNSLEVRESLEVLAGGGPADVVELTCALAREMLEAAGVHDA
DVAAALADGRAMDTWRAMISAQGGDVDAPLPVAQHVEEVRAAQDGVVTGLDAMGVGVAAW
RLGAGRSRPGEAVQAAAGVEIAAHVGDTVRAGDVLARLHTDTPGRIARALEAIDGSWSLA
APGTAAPERRIVLDRIV
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgccaccgcagaccccgccgtcgagcccttcgacgtcgtcgacgtgatccgc
accaagcgcgacgggggccgtctcgagggcggccagatcgactgggtgatcgacgcctac
acccgcggcgtcgtcgccgaggagcagatggccgccctcgccatggcgatcttcctgcgc
ggcatggagcgccccgagatcgcccgttggacgagcgcgatgatcgacaccggcgagcgg
atggacttctccgccctctccaagcccaccaccgacaagcactccaccggcggggtgggg
gacaagatcaccctgccgctggccccgctggtcgcctccttcggcgtggcggtgccgcag
ctgtccggccgcggcctgggacacaccgggggcaccctcgacaagctcgaggccatcccc
ggctggcgcgccgcactgaccaacgacgagatgatggcgcagctcgagagcgtgggcgcg
gtgatctgcgcggccggctccggtctcgccccggcggacaagaagctctatgcgctgcgc
gacgtcaccggcaccgtcgaggcgatcccgctgatcgcctcctcgatcatgtcgaagaag
atcgccgagggcactgccgcgctgaccctcgacgtgaagaccggcgccggggcgttcatg
aaggacgaggccgacgcccgcgagctcgcccgcacgatggtcgagctcggcaccgacgcc
gggacgcgcaccgtcgccctgctcaccgacatgtccgcaccgctgggccgcaccgccggc
aacagcctcgaggtgcgcgagtccctcgaggtgctcgccggcggcggtccggccgacgtg
gtcgagctgacctgcgccctggcccgcgagatgctcgaggcggccggggtgcacgacgcc
gacgtcgcggccgcgctcgccgacgggcgggcgatggacacctggcgcgcgatgatctcc
gcgcagggcggcgacgtggacgcgcccctgccggtcgcacagcacgtcgaggaggtccgt
gccgcgcaggacggcgtcgtcaccgggctcgatgcgatgggcgtgggggtcgcggcgtgg
cggctcggcgccggacgctcccgcccgggggaggccgtgcaggccgccgccggcgtcgag
atcgccgcacacgtgggagacaccgtacgtgccggggacgtgctcgcccggctgcacacc
gacacccccggccgcatcgcccgcgcgctcgaggcgatcgacggatcctggagcctcgcc
gcaccgggcacggcggcccctgagcgacggatcgtgctggaccgcatcgtctga

DBGET integrated database retrieval system