KEGG   Brachybacterium faecium: Bfae_21320Help
Entry
Bfae_21320        CDS       T00965                                 

Definition
succinate dehydrogenase subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bfa  Brachybacterium faecium
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bfae_21320
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bfae_21320
   00650 Butanoate metabolism
    Bfae_21320
  Energy metabolism
   00190 Oxidative phosphorylation
    Bfae_21320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2391064..2391516
Genome map
AA seq 150 aa AA seqDB search
MTSTTSIPDPSTRYRRTGQRGLNSEMLSWMFMRASGVLLVILVFGHLFVNLWLGQGVKGI
DFAFVGGKWASPFWQVWDLLMLWLGLIHGGNGVRTIINDYARGDRLRLVLKGLLYFAVVV
TIILGTLVIFTFDPCPTGAEPSLLPSFCEG
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaccacctcgatccccgatccgagcacccgctaccgccgcaccggccagcgc
ggtctgaactccgagatgctctcgtggatgttcatgcgcgcctccggcgtgctgctggtg
atcctcgtgttcggccacctgttcgtgaacctctggctcggccagggcgtcaagggcatc
gacttcgccttcgtgggcggcaagtgggcctcccccttctggcaggtctgggacctgctc
atgctgtggctgggcctcatccacggcggcaacggcgtgcgcacgatcatcaacgactat
gcgcgcggcgaccggctccgcctggtcctcaagggcctgctctacttcgccgtggtcgtc
acgatcatcctgggcacgctggtgatcttcaccttcgatccctgccccaccggcgccgag
ccgagcctgctgccctccttctgcgagggctga

DBGET integrated database retrieval system