KEGG   Brachybacterium faecium: Bfae_22210Help
Entry
Bfae_22210        CDS       T00965                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
bfa  Brachybacterium faecium
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bfae_22210
Enzymes [BR:bfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Bfae_22210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2493744..2496215
Genome map
AA seq 823 aa AA seqDB search
MTATASWPNSPSSAPTPEELARLHAWWRAANYLSVGQIYLKDNPLLRQPLQREHVKPRLL
GHWGTTPGLTFLYAHANRAIRQRGLRAMYITGPGHGGPGLVASTYLEGTYSEVYPAVSED
EAGMKRLFTQFSFPGGIPSHVAPETPGSIHEGGELGYALSHAYGAMFDSPDQIAFTVVGD
GEAETGPLATSWHSNKFVNPQQDGVVLPILHLNGYKIANPTVLARIGEDELEALLRGCGH
TPLFFTGGFDDEDPLEIHERFAAVLDEALDQIAEIKQRAFEDAAAGRETERPAWPMIVLR
TPKGWTGPKEIDGQQTEGSWRSHQVPLASARDTDEHLADLDAWLRSYRPEELFDEDGRLL
EDIAAAAPSGALRMSANPSTNGGSVLTPLRLPDFRDYAVEVPSPGGTVAEATKVLGTWLR
DVIRDNPRTFRLFGPDETASNRLQAVYEATDKQWNARLEEHDRTEHLARAGRVMEVLSEH
QCQGWLEGYLLTGRHGMFSSYEAFIHIVDSMVNQHAKWLKVTNELEWRRPIASLNYLLSS
HVWRQDHNGFSHQDPGFIDHMVNKKAEIVRVYLPPDANTLLSTYDHCLRSRQYVNVVVAG
KQPGPTWLDMDEAIVHCTRGLGIWDWAGTEQPGREPDVVLAGAGDIPTIEVLAAAKILRT
EIPELRVRVVNVVDLMRLQDDSEHPHGLSQRDFDGYFGQDVPVVFAYHGYPWLIHRLAYR
HDRGSRIHVRGYKEEGTTTTPFDMLMLNDSDRYHLVMDVIDRVEGLGTRYAALRQRMVDT
RLRARAFAYEHGEDVPEITRWQWGDGGDAAPAGAPADTGGDNE
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgaccgccagctggccgaactctccctcctccgccccgacccctgaggagctc
gcccggctccacgcctggtggcgggccgcgaactacctctccgtgggccagatctacctc
aaggacaacccgctgctgcgccagccgctgcagcgcgagcacgtcaagccgcgcctgctc
gggcactggggcaccaccccggggctgacgttcctgtacgcgcacgcgaaccgggcgatc
cgccagcgcgggctgcgcgccatgtacatcaccgggcccggccacggcggtcccggcctg
gtcgcctcgacctacctcgagggcacctactccgaggtgtacccggcggtgagcgaggac
gaggcggggatgaagcggctgttcacccagttctccttccccggcggcatcccctcgcac
gtcgcccccgagaccccgggatcgatccatgagggcggcgagctcggctacgcgctctcc
cacgcctacggcgcgatgttcgacagccccgaccagatcgcgttcaccgtcgtcggcgac
ggcgaggcggagaccggaccgctggccacctcgtggcactcgaacaagttcgtcaacccg
cagcaggacggcgtggtgctgccgatcctgcacctgaacggctacaagatcgcgaacccg
accgtgctggcgcggatcggggaggacgagctggaggcgctgctgcgcggctgcggccac
accccgctgttcttcaccggcggcttcgacgacgaggacccgctggagatccacgagcgc
ttcgccgcggtgctcgacgaggcgctggaccagatcgccgagatcaagcagcgggccttc
gaggacgccgccgccgggcgggagaccgagcgcccggcctggccgatgatcgtgctgcgc
accccgaagggctggaccggcccgaaggagatcgacggccagcagaccgagggctcctgg
cgctcccaccaggtgccgctggccagcgcccgcgacaccgacgagcacctcgcggatctc
gacgcctggctgcgctcctaccgtcccgaggagctgttcgacgaggacggcaggctcctc
gaggacatcgccgcggccgccccgagcggtgcgctgcggatgtccgcgaatccctcgacc
aacggcggctcggtgctgaccccgctgcgcctgccggacttccgcgactatgcggtggag
gtcccctcccccggcggcaccgtcgccgaggcgaccaaggtgctcggcacctggctgcgg
gacgtgatccgcgacaatccccgcaccttccggctcttcgggcccgacgagaccgcctcg
aaccgcctgcaggccgtctacgaggccaccgacaagcagtggaacgcacggctggaggag
cacgaccgcaccgagcacctggcccgggccggccgggtcatggaggtgctctccgagcac
cagtgccagggctggctcgagggctatctgctcaccgggcggcacggcatgttctcctcc
tacgaggcgttcatccacatcgtcgactcgatggtcaaccagcacgcgaagtggttgaag
gtgacgaacgagctcgagtggcgccgcccgatcgcctcgctgaactacctgctgagctcg
cacgtgtggcggcaggaccacaacggcttctcgcaccaggatccgggcttcatcgatcac
atggtcaacaagaaggcggagatcgtgcgggtctacctcccgccggacgcgaacacgctg
ctgtccacctacgatcactgcctgcgctcgcggcagtacgtgaacgtggtggtggccggg
aagcagccgggccccacctggctcgacatggacgaggcgatcgtgcactgcacccgcggg
ctggggatctgggactgggccggcaccgagcagcccggccgggaaccggacgtcgtgctc
gccggcgccggggacatccccaccatcgaggtgctggcggccgcgaagatcctgcgcacg
gagatcccggagctcagggtccgggtggtcaacgtggtcgacctgatgcgcctccaggac
gattcggagcacccgcacggcctctcccagcgggacttcgacggctatttcgggcaggac
gtcccggtggtgttcgcctaccacggctatccgtggctgatccaccgcctggcctaccgc
cacgaccgcggctcacggatccacgtgcgcggctacaaggaggagggcaccaccaccacg
cccttcgacatgctgatgctcaacgactccgaccgctaccacctggtgatggacgtgatc
gaccgggtggaggggctcggcacccggtacgcggcgctgcgccagcggatggtggacacg
cggctgcgagcccgcgccttcgcctacgagcacggcgaggacgtccccgagatcacccgg
tggcagtggggggacggcggcgatgcggcgcccgccggcgccccggcagataccggcggc
gacaacgagtga

DBGET integrated database retrieval system