KEGG   Brachybacterium faecium: Bfae_22590Help
Entry
Bfae_22590        CDS       T00965                                 

Definition
glycosidase
Orthology
K01187  
alpha-glucosidase [EC:3.2.1.20]
Organism
bfa  Brachybacterium faecium
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bfa00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bfa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2539583..2541250
Genome map
AA seq 555 aa AA seqDB search
MSMLTAKHRAATMIHPGTAADQWWRTAVIYQIYPRSFSDSDGDGAGDLQGITDRLPYLRD
LGVDALWLSPFYPSPQVDGGYDISDHQDVDPLFGTLDDADELIRRAHDHGLRVLIDIVPN
HTSDQHPWFREALEAQPGSPARDRYVFVDADGPYNNWPSEFGGPAWTQVADGQWYLHLFD
PAQPDLNWRNPEVRELFLETMRFWLDRGVDGFRIDVPHHLIKADGLPDLDVPWEDYVRGD
HPTSAAPFADQEGLHEIFREWRTLLESYPGQRAMVAEAWVAPHDRLARYIRPDEFHQAFN
FDVLALRWDAADVRRRVTESYAAADAVGAPTTWVLSNHDVMRHASRLVRSDPAQAPWVLP
SSEQAPDSSAGLRRARAATALLLALPGSAYLYQGEELGLPEVLDLPDEARRDPTFARTAG
RLRGRDGCRMPLPWSASGPSFGFSEAEETWLPMPAGFSAYAADAQDHDPDSTLRLYRQLL
RLRRERRLGTGTASLCDLGPDLLGLLIETDIGTTMVVTNFSDSSWMIPSDAEMLVSSTPI
ARGALGRDQSVWLAL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgctgacggcgaagcaccgcgctgcgacgatgatccatccgggcaccgctgct
gaccagtggtggcgcaccgccgtgatctaccagatctatccccgatcgttctccgactcc
gacggcgacggggccggggacctgcaggggatcaccgaccgcctgccctatctgcgggac
ctcggcgtggacgccctgtggctctcccccttctatccctcgccccaggtggacggtgga
tatgacatctcggaccaccaggacgtggacccgctgttcgggactctcgacgatgccgac
gagctcatccgtcgggcgcacgatcacggcttgcgggtcctgatcgacatcgtccccaac
cacaccagtgatcagcatccatggttccgcgaggcgctggaggcgcagcccggttccccc
gcacgggaccgctacgtgttcgtcgacgcggacggcccgtacaacaactggccctcggag
ttcggcggcccggcatggacccaggtggcggacggacagtggtacctgcacctcttcgac
cccgctcagcccgacctcaactggaggaacccagaggtccgcgagctcttcctcgagacg
atgaggttctggctcgatcgcggggtggacggattccggatcgatgtcccccatcatctg
atcaaggccgatggactgcctgatctcgacgtgccctgggaggactacgtcagaggggac
caccccacatccgccgcgcccttcgccgaccaggagggcctgcacgagatcttccgcgaa
tggcgcaccctgctcgagagctacccgggacagcgggcgatggtcgccgaagcgtgggtc
gcaccgcacgaccgcctggcccgctacatccgacccgacgagttccatcaggcgttcaac
ttcgatgtcctcgccctgcgctgggatgcggccgacgtacggcgccgggtgacggagagc
tatgccgcggccgacgcggtcggcgcgccgacgacctgggtgctgtccaatcatgacgtc
atgcgccatgcgagccgtctggtccgctccgatcccgcccaggccccgtgggtgctgccc
tcctccgaacaggccccggacagctccgccggtctgcgccgggcccgggccgccaccgct
ctgctgctcgcgctccccggcagcgcatacctctaccagggagaggagctcggcctaccg
gaggtgctcgacctgcccgacgaggcccgccgcgatccgacgttcgcccgcacggcgggg
cgtctgcgcggacgcgacggctgccggatgccgcttccctggagcgcctcgggcccgtcc
ttcgggttcagcgaggccgaggagacgtggctgcccatgcccgcgggcttctcggcgtac
gcggccgacgcccaggatcacgaccccgactcgaccctccgcctctaccgtcagctgctg
cgtctccgccgggaacggcgcctcggcaccggcacggcctctctgtgcgatctcgggccg
gatctgctcgggctcctgatcgagaccgacatcgggacgaccatggtcgtcacgaatttc
agcgactcctcgtggatgatcccctcggacgccgagatgctggtgtccagcactcccatc
gcgcgcggagcgctcggtcgggaccagtccgtgtggctcgcgctctga

DBGET integrated database retrieval system