KEGG   Brachybacterium faecium: Bfae_22590Help
Entry
Bfae_22590        CDS       T00965                                 

Definition
glycosidase
Orthology
K01187  
alpha-glucosidase [EC:3.2.1.20]
Organism
bfa  Brachybacterium faecium
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bfae_22590
   00500 Starch and sucrose metabolism
    Bfae_22590
Enzymes [BR:bfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Bfae_22590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2539583..2541250
Genome map
AA seq 555 aa AA seqDB search
MSMLTAKHRAATMIHPGTAADQWWRTAVIYQIYPRSFSDSDGDGAGDLQGITDRLPYLRD
LGVDALWLSPFYPSPQVDGGYDISDHQDVDPLFGTLDDADELIRRAHDHGLRVLIDIVPN
HTSDQHPWFREALEAQPGSPARDRYVFVDADGPYNNWPSEFGGPAWTQVADGQWYLHLFD
PAQPDLNWRNPEVRELFLETMRFWLDRGVDGFRIDVPHHLIKADGLPDLDVPWEDYVRGD
HPTSAAPFADQEGLHEIFREWRTLLESYPGQRAMVAEAWVAPHDRLARYIRPDEFHQAFN
FDVLALRWDAADVRRRVTESYAAADAVGAPTTWVLSNHDVMRHASRLVRSDPAQAPWVLP
SSEQAPDSSAGLRRARAATALLLALPGSAYLYQGEELGLPEVLDLPDEARRDPTFARTAG
RLRGRDGCRMPLPWSASGPSFGFSEAEETWLPMPAGFSAYAADAQDHDPDSTLRLYRQLL
RLRRERRLGTGTASLCDLGPDLLGLLIETDIGTTMVVTNFSDSSWMIPSDAEMLVSSTPI
ARGALGRDQSVWLAL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgctgacggcgaagcaccgcgctgcgacgatgatccatccgggcaccgctgct
gaccagtggtggcgcaccgccgtgatctaccagatctatccccgatcgttctccgactcc
gacggcgacggggccggggacctgcaggggatcaccgaccgcctgccctatctgcgggac
ctcggcgtggacgccctgtggctctcccccttctatccctcgccccaggtggacggtgga
tatgacatctcggaccaccaggacgtggacccgctgttcgggactctcgacgatgccgac
gagctcatccgtcgggcgcacgatcacggcttgcgggtcctgatcgacatcgtccccaac
cacaccagtgatcagcatccatggttccgcgaggcgctggaggcgcagcccggttccccc
gcacgggaccgctacgtgttcgtcgacgcggacggcccgtacaacaactggccctcggag
ttcggcggcccggcatggacccaggtggcggacggacagtggtacctgcacctcttcgac
cccgctcagcccgacctcaactggaggaacccagaggtccgcgagctcttcctcgagacg
atgaggttctggctcgatcgcggggtggacggattccggatcgatgtcccccatcatctg
atcaaggccgatggactgcctgatctcgacgtgccctgggaggactacgtcagaggggac
caccccacatccgccgcgcccttcgccgaccaggagggcctgcacgagatcttccgcgaa
tggcgcaccctgctcgagagctacccgggacagcgggcgatggtcgccgaagcgtgggtc
gcaccgcacgaccgcctggcccgctacatccgacccgacgagttccatcaggcgttcaac
ttcgatgtcctcgccctgcgctgggatgcggccgacgtacggcgccgggtgacggagagc
tatgccgcggccgacgcggtcggcgcgccgacgacctgggtgctgtccaatcatgacgtc
atgcgccatgcgagccgtctggtccgctccgatcccgcccaggccccgtgggtgctgccc
tcctccgaacaggccccggacagctccgccggtctgcgccgggcccgggccgccaccgct
ctgctgctcgcgctccccggcagcgcatacctctaccagggagaggagctcggcctaccg
gaggtgctcgacctgcccgacgaggcccgccgcgatccgacgttcgcccgcacggcgggg
cgtctgcgcggacgcgacggctgccggatgccgcttccctggagcgcctcgggcccgtcc
ttcgggttcagcgaggccgaggagacgtggctgcccatgcccgcgggcttctcggcgtac
gcggccgacgcccaggatcacgaccccgactcgaccctccgcctctaccgtcagctgctg
cgtctccgccgggaacggcgcctcggcaccggcacggcctctctgtgcgatctcgggccg
gatctgctcgggctcctgatcgagaccgacatcgggacgaccatggtcgtcacgaatttc
agcgactcctcgtggatgatcccctcggacgccgagatgctggtgtccagcactcccatc
gcgcgcggagcgctcggtcgggaccagtccgtgtggctcgcgctctga

DBGET integrated database retrieval system