KEGG   Brachybacterium faecium: Bfae_23360Help
Entry
Bfae_23360        CDS       T00965                                 

Definition
protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bfa  Brachybacterium faecium
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2616162..2616752)
Genome map
AA seq 196 aa AA seqDB search
MRPDRVDRAMQEVPRERFLPAPLRERAVEDAPLPIGDGQTNSQPTTVRNMLRLLDVREGQ
RVLDLGAGSGWTTALLAHLVGPAGSVLGVERQRSLLGPARAALAETLAAPGAGGGRAEIR
EARPGVLGAPEDGPFDRILVSAAARRRPPALLDQLADGGVLVLPVRERMLRIRRRGAELE
ETDHGAYLFVPLIEED
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcgacccgatcgcgtcgaccgcgcgatgcaggaggtgccgcgagagcgcttcctccct
gccccgctgagggaacgggccgtcgaggatgcgccgctgccgatcggcgacggccagacc
aactcccagcccacgaccgtgcggaacatgctccgcctgctggacgtgcgcgaggggcag
cgggtgctcgacctcggcgccggctccggctggaccaccgcgctgctggcccacctcgtc
ggccccgccgggagcgtgctcggcgtggagcggcagcggagcctgctgggtccggcgcgg
gccgcgctcgccgagacgctggcggctccgggagcgggcggcggccgcgcggagatccgc
gaggcccggcccggcgtcctcggcgcgccggaggacggccccttcgaccggatcctcgtc
tccgccgccgcccggcgccgcccgcccgcgctgctcgaccagctcgccgacggcggggtg
ctggtgctgcccgtgcgggagcggatgctgcggatccgtcgccgcggcgcggagctcgag
gagacggatcacggcgcctacctgttcgtcccgctcatcgaggaggactga

DBGET integrated database retrieval system