KEGG   Brachybacterium faecium: Bfae_26320Help
Entry
Bfae_26320        CDS       T00965                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bfa  Brachybacterium faecium
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bfae_26320
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bfae_26320
Enzymes [BR:bfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bfae_26320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2928056..2929465
Genome map
AA seq 469 aa AA seqDB search
MPDPIALVPLPQSVVWSDGTWETNDPWDGLSVGLNDALPATEYALSISPTGASLTAGSEA
ALADGRNTFAQIVTGANGAIPCVTISDRPEHAWRGMHLDVSRHFLPVEEIETLIDGLALH
RLNVLHLHLTDDQGWRVEIKGYPRLTEVGAWREQTLVGHMSGDEESWTFDGTRHGGFYTQ
EELTGLVEYARKRGIMIVPEIDLPGHMQAAIAAYPELGNFPEQQLGVREVWGISDHVLGV
SDEVFDFLRDVLTQVADIFPAPYVHIGGDECPRTEWERSSAARARMNEWGLTRVSEIQGR
FTQFAADVLAEKGKRIIAWDEVLESHLPDDTVIMNWRHGNGVKDSTSRGFQTIIANNEHL
YFDHYQGDPAQEPLAIGGRTTLKDVYTAAFSPRKLEDAQEKLILGLQGQIWTEYMPNAAQ
VQYMAFPRLCALAERAWGSPEQSWEEFEERLRAHLPRLDAFGIRYRPLD
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaccccatcgccctcgtcccgctcccccagtccgtcgtgtggtcggacggcacg
tgggagacgaacgatccctgggacggtctctccgtcgggctcaacgacgccctgcccgcc
accgagtacgcgctgtcgatctcgcccaccggcgcctcgctcacggccggcagcgaggcg
gcgctggccgacgggcgcaacaccttcgcccagatcgtcaccggcgcgaacggcgcgatc
ccctgcgtgacgatctccgacaggcccgagcacgcctggcgcggcatgcacctggacgtc
tcccgccacttcctgccggtcgaggagatcgagaccctcatcgacggtctcgccctgcac
cgcctgaacgtgctgcacctccacctcaccgatgatcagggctggcgcgtggagatcaag
ggctacccgcgcctgaccgaggtgggcgcgtggcgcgagcagaccctcgtgggccacatg
agcggcgacgaggagtcctggaccttcgacggcacccgccacggcgggttctacacccag
gaggagctgaccgggctcgtcgagtacgcccgcaagcgcggcatcatgatcgtgcccgag
atcgacctgcccgggcacatgcaggccgcgatcgccgcctacccggagctggggaacttc
cccgagcagcagctcggcgtgcgcgaggtgtggggcatctccgaccacgtgctcggcgtc
tccgacgaggtgttcgacttcctgcgggacgtgctcacccaggtggcggacatcttcccc
gccccctacgtgcacatcggcggtgacgagtgcccgcgcacggagtgggagcgctcctcc
gccgcccgcgcccgcatgaacgagtggggcctcacccgcgtctccgagatccagggccgc
ttcacccagttcgccgcggacgtcctcgccgagaagggcaagcggatcatcgcctgggac
gaggtgctcgagagccacctgcccgacgacaccgtgatcatgaactggcgccacggcaac
ggggtgaaggattccacctcgcgcggcttccagacgatcatcgcgaacaacgagcacctc
tacttcgaccactaccagggcgatcccgcgcaggagccgctcgcgatcggtggtcgcacc
acgctcaaggacgtgtacaccgccgcgttcagcccccgcaagctcgaggacgcgcaggag
aagctgatcctcggcctgcagggccagatctggaccgagtacatgccgaatgcggcgcag
gtgcagtacatggcgttcccgcgcctgtgcgccctggccgagcgcgcctggggctccccg
gagcagagctgggaggagttcgaggagcggctgcgcgcgcacctgccgcgcctggacgcc
ttcgggatccgctaccgccccctggactga

DBGET integrated database retrieval system