KEGG   Brachybacterium faecium: Bfae_26640Help
Entry
Bfae_26640        CDS       T00965                                 

Definition
beta-galactosidase/beta-glucuronidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bfa  Brachybacterium faecium
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bfae_26640
  Lipid metabolism
   00600 Sphingolipid metabolism
    Bfae_26640
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bfae_26640
Enzymes [BR:bfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Bfae_26640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2972220..2975210
Genome map
AA seq 996 aa AA seqDB search
MSTPLPSADRTDRWWEELPAGRNRLRGRAHLHTDAPALNLDGTWEFRYGTRADGSDLGES
AEIAVPGLWQLQGYGAPQYTNVIYPIPRDVPHVPDENPTGHYSRTLTVPEEWTEQLAGGA
RILLRFQGVDSAAKVWIDGTEIGVTAGSRLTQEFDVTEALTAEAPHGEHRLDVRVVQWSV
NTYVEDQDMWWASGIFRSVDLLLRPVGGIHDLVTDADFDPATGEGALRVTALDADGAELA
ATVEVPDLGHSAATGARALSVGEVRPWSAEDPHLYDATVRTATETVTLRLGFRRVEVDGE
IFRVNGERIVFRGVNRHEADPVVGRTQHLQNQDLDVALMKQHNLNAVRTSHYPPHQRFLD
VCDEAGLYVICEGDFETHGFHADSTWGEDGTGAAEGPAQNPLFEESLVERSERFVLRDRH
HASIVMWSIGNEAASGPVAEAMVARVRETDPTRPVIYEQDYAAEYVDVFSLMYSSIDEST
QIGERSLSPEYQDKLTRMLRGFALDVPEGHFADPPALHKPFLWIEYAHAMGNGAGSLEEY
MALTEKYPALHGGFIWEWIDHGLETTDAEGNRIYGYGGDFGERLHDGNFVADGLVLPDRT
PSPALLDAKHHYSPVGLEVSPGTARIVNRYAFSDLSHLRAEVSVDAQASWQELELPTIAP
GESVEVALPAHEGATTTVRLLTREAQGPVPAGHTIVAADHVDPARLRAALTPSAAAAAAP
EQGEDGSWSLGPARFDDLGRLVGLGDLAVEGAGVDLYRAPVDNERARTRAPLEARWKRIG
LDHARRRLVEISAEGSALLVRSRLGLDGSALGADVTERWSGDAEGVDVEVTVTPSAFWPE
DLPLPRIGWTFALPSAPDEVEYEGFGPHESYPDTGGGTTFARWSSSLAEFQVPYVFPQEN
GNRAGVVRAALRGAAGAALALEAPDGLGLAVRPWSTAELDARAHDGALRPDGRTWVTLSA
ALQGVGSAACGPEPLPQYVLSAREESFRFRLAPTAG
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgctgccgtccgccgaccgcaccgaccgctggtgggaggagctgcccgcc
ggccgcaaccgcctgcgcggccgcgcccacctgcacaccgacgcccccgccctgaacctc
gacgggacctgggagttccgctacggcacccgggccgacggctctgacctcggcgagagc
gccgagatcgccgtgcccgggctgtggcagctgcagggctacggcgccccgcagtacacc
aacgtcatctatccgatcccccgcgacgtcccgcacgtgccggacgagaaccccaccggc
cactactcccgcacgctcaccgtgcccgaagagtggaccgagcagctcgccggcggggcc
cgcatcctgctgcgcttccagggcgtggactccgcggcgaaggtgtggatcgacggcacc
gagatcggggtgaccgccggctcgcgcctcacccaggagttcgacgtcaccgaggcgctc
accgccgaggccccccatggcgagcaccggctcgacgtgcgcgtggtgcagtggtcggtg
aacacctacgtcgaggaccaggacatgtggtgggcctcgggcatcttccgcagcgtggac
ctgctgctgcggcccgtgggcgggatccacgacctggtcaccgacgcggatttcgacccc
gccaccggcgagggcgccctgcgggtgaccgcgctcgacgcggacggcgccgagctcgcc
gccaccgtcgaggtcccggatctcgggcactcggccgccaccggcgcgcgggcgctctcg
gtcggcgaggtgcggccgtggtccgccgaggatccgcacctgtacgacgcgaccgtgcgc
accgcgaccgagaccgtcacgctgcgcctgggcttccgccgcgtcgaggtggacggggag
atcttccgcgtcaacggcgagcgcatcgtgttccgcggagtgaaccggcacgaggccgat
ccggtggtgggccgcacccagcaccttcagaaccaggatctcgacgtcgcgctcatgaag
cagcacaacctcaacgccgtgcgcacctcccactacccgccccatcagcggttcctcgac
gtgtgcgacgaggccggcctgtacgtgatctgcgagggcgacttcgagacccacggcttc
cacgccgattccacctggggcgaggacggcaccggcgcggccgaggggccggcgcagaac
ccgctgttcgaggagtccctggtggagcgttcggagcggttcgtgctccgcgaccgccac
cacgcctcgatcgtcatgtggtcgatcggcaacgaggccgcctccgggccggtcgccgag
gcgatggtggcgcgggtgcgggagacggaccccacccgtccggtgatctacgagcaggac
tacgccgcggagtacgtggacgtgttctcgctgatgtactcctcgatcgacgagtccacg
cagatcggcgagcgcagcctctcgcccgagtaccaggacaagctcacccgcatgctgcgc
ggcttcgcgctggatgtccccgagggccacttcgcggatccgccggcgctgcacaagccg
ttcctgtggatcgagtacgcgcacgcgatgggcaacggcgccggctccctcgaggagtac
atggcgctcacggagaagtacccggcgctgcacggcgggttcatctgggagtggatcgat
cacggcctggagaccaccgacgccgaggggaaccgcatctacggctacggcggcgacttc
ggcgagcgcctgcacgacgggaacttcgtggccgatgggctggtgctgccggaccgcacg
ccctccccggcgctgctggatgcgaagcaccactactcccccgtgggcctcgaggtctcc
cccggcacggcgcggatcgtgaaccgctacgccttcagcgacctctcccacctgcgcgcc
gaggtgtccgtggacgcccaggccagctggcaggagctcgagctgcccacgatcgccccg
ggggagagcgtcgaggtggcgctgcccgcgcacgagggggcgaccaccacggtgcggctg
ctcacccgcgaggcgcagggcccggtcccggccgggcacacgatcgtcgccgcggatcac
gtggatcccgcacggctgcgcgccgcgctcaccccgtcggccgccgctgcggcggccccg
gagcagggcgaggacggctcctggagcctcggcccggcccgcttcgacgacctgggccgc
ctggtgggcctgggcgatctcgcggtcgagggcgccggggtggatctgtaccgcgcgccg
gtggacaacgagcgggcccgcacccgcgccccgctcgaggcacgctggaagcggatcggc
ctggaccacgcccggcgccgtctggtggagatctccgccgagggctccgcgctcctcgtg
cgcagccggctcgggctggacggctcggcgctgggcgccgacgtcaccgagcgctggagc
ggtgacgcggagggcgtggacgtggaggtgacggtcaccccgtcggcgttctggccggag
gacctgccgctgccgaggatcggctggaccttcgcgctgccctcggccccggacgaggtg
gagtacgagggcttcggcccgcacgagtcctacccggacaccggcggcggcaccaccttc
gcccgctggtcctcctcgctcgccgagttccaggtcccgtacgtgttcccgcaggagaac
ggcaatcgggcgggcgtggtgcgtgccgcgctgcgcggcgcggcgggcgcggccctcgcg
ctcgaggcgcccgacgggctggggctcgcggtgcgtccctggtcgaccgcggagctcgac
gcccgcgcgcacgacggggcgctgcgtcccgacgggcgcacctgggtgaccctctccgcg
gcgctgcagggcgtgggctcggcggcgtgcgggccggagccgctgccgcagtacgtgctc
tccgcacgggaggagagcttccgcttccgtctggccccgacggccggctga

DBGET integrated database retrieval system