KEGG   Brachybacterium faecium: Bfae_26760Help
Entry
Bfae_26760        CDS       T00965                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bfa  Brachybacterium faecium
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bfae_26760
Enzymes [BR:bfa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Bfae_26760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2990868..2992331
Genome map
AA seq 487 aa AA seqDB search
MSTRVLVVGGGLAGLLAARRHQRAGRRVVLLEAGDAVGGAIASARLEEAGGLALNTGAEA
YSTASGAVDALVAELGLAAQVVAPREGLGSHVVSDAGVHRAPAGALLGVPGHPLAADVRA
VLGTAGALRASLERLLPASYGAREGATVAEVVGRRLGPKVLQRLVAPVVGGVHSADPATL
EFAAASPALRRGLTEHGSLVAAVHRLRGGAGQRRAGQRGGASAGTRVHALTPTMAALPET
LRAQLLDGGAILRTGVEVTGLDRAAAADTSTSTAAWTVRTSREERLEADHLVLACPPDTA
RDLLRAAAPEIAGAIPQAPSAAVRLVALVLDAPALDALPAGTGALVAPGTAGIGAKALTH
ASAKWEHVQQALREALPAAASPHLLRLSYGRPGEQLPAREGIVDLALADASRILRTPLGR
AQLRAAEVIDWDRAMRQALPGHRAALDSLDALLSQQPSLELVGSWRAGTGIDAIVRADRS
LTEGSAS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcgcgtcctcgtcgtcggcggcggcctggccggtctgctcgccgctcgccgg
catcagcgggccgggcgccgcgtggtgctgctcgaggccggcgatgccgtcggcggggcg
atcgcctcggcccggctcgaggaggccggcggcctggccctgaacacgggcgccgaggcg
tactcgaccgcgtccggggcggtcgacgccctggtcgcggagctggggctggccgcgcag
gtggtcgccccgcgcgagggcctgggcagccacgtggtctccgacgcgggcgtgcaccgc
gcgcccgccggggcgctgctcggcgtgccggggcacccgctcgcggccgacgtccgggcg
gtgctgggcaccgcgggggcgctgcgtgcgagcctcgagcgcctcctgcccgcctcctac
ggcgcccgggagggggcgaccgtcgccgaggtggtggggcgccgcctcgggccgaaggtg
ctgcagcgcctggtcgcccccgtggtgggcggggtgcactccgccgatccggcgaccctc
gagttcgcggccgcctccccggcgctgcgacggggcctgaccgagcacggctcgctcgtg
gccgccgtgcacaggctccggggcggggccggacagcgacgggccgggcagcggggcggg
gcgagcgccggcacccgcgtccacgccctgacccccaccatggccgccctgcccgagacg
ctgcgggcccagctgctcgacggcggggcgatcctgcgcaccggggtggaggtgaccggc
ctggaccgcgccgcggccgccgacaccagcaccagcaccgccgcctggaccgtgcgcacc
tcccgcgaggagcgcctcgaggcggaccacctggtcctcgcctgcccgccggacaccgcc
cgcgacctgctgcgcgcggccgcaccggagatcgcgggcgccatcccgcaggccccgtcg
gccgcggtgcgcctggtggcgctggtgctcgacgcccccgcgctcgacgccctccccgcc
ggcaccggcgccctggtcgcgcccggcaccgccgggatcggggcgaaggcgctcacccat
gcgagcgcgaagtgggagcacgtgcagcaggcgctgcgcgaggcgctccccgccgccgcg
agcccgcacctgctgcggctgtcctacggccggcccggcgagcagctgcccgcccgcgag
gggatcgtggacctcgccctcgccgacgcctcccgcatcctgcgcaccccgctcggtcgc
gcgcagctgcgcgccgcggaggtgatcgactgggaccgggcgatgcgccaggccctgccc
ggtcaccgcgccgcgctcgactccctcgacgcgctgctgtcccagcagccgtccctcgaa
ctcgtcggctcctggagagccggcaccggcatcgacgcgatcgtccgcgccgaccgctcc
ctcacggaaggatccgcctcatga

DBGET integrated database retrieval system